PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00137641001
Common NameGSBRNA2T00137641001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 122aa    MW: 13705.9 Da    PI: 9.0581
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00137641001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.56.3e-4051041100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+C+kdC+++pyfp ++p kf ++h+++Ga nv+k+l++lp ++r +a++sl +eA++r++dPvyG+vg+i+ lq q++++
  GSBRNA2T00137641001   5 RCAACKYLRRRCPKDCIFSPYFPPSDPDKFSYIHRIYGAGNVSKMLQQLPVQTRAEAVESLSFEARCRVEDPVYGCVGIISLLQTQIQKT 94 
                          6***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++ la++++e
  GSBRNA2T00137641001  95 QTLLAKTQAE 104
                          ***9999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.7634105IPR004883Lateral organ boundaries, LOB
PfamPF031956.4E-395102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MNPKRCAACK YLRRRCPKDC IFSPYFPPSD PDKFSYIHRI YGAGNVSKML QQLPVQTRAE  60
AVESLSFEAR CRVEDPVYGC VGIISLLQTQ IQKTQTLLAK TQAEIAVAQN KQSQSQISEF  120
M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-38610512111LOB family transfactor Ramosa2.1
5ly0_B5e-38610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00137641001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018483059.12e-80PREDICTED: LOB domain-containing protein 23
SwissprotP594671e-73LBD23_ARATH; LOB domain-containing protein 23
TrEMBLA0A398A7B94e-83A0A398A7B9_BRACM; Uncharacterized protein
STRINGXP_006401849.17e-76(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.16e-63LOB domain-containing protein 23
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]