PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00137531001
Common NameGSBRNA2T00137531001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 338aa    MW: 36593.9 Da    PI: 9.4247
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00137531001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.27.6e-13117161347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ l++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
  GSBRNA2T00137531001 117 PWTEEEHRLFLVGLRKLGKGDWRGISRNYVMSRTPTQVASHAQKY 161
                          8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.576110166IPR017930Myb domain
SuperFamilySSF466893.81E-16112164IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-17113164IPR006447Myb domain, plants
SMARTSM007172.7E-10114164IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-10116160IPR009057Homeodomain-like
CDDcd001673.99E-9117162No hitNo description
PfamPF002495.5E-11117161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RGSGTCGGLG GSSSSAVKLF GVRLTDGSIV KKSASMGNLS  60
ALAVSPSFPL AMGNHSDSPL SDHARYSNQD NEGYLSDDPA RGFGPIHRRV ERKRGVPWTE  120
EEHRLFLVGL RKLGKGDWRG ISRNYVMSRT PTQVASHAQK YFIRHACSSR RKRRSSLFDM  180
VTDSLPTQED TSSPSKELKN KTYLPSLELS LNNTTESEVV TTTAPPQGEL EEAIEPSNGL  240
STMLVPSGYF PPCFPVTCTI WLPASSTSLQ GTEHSLEAET SSQQHHVLKP KPGFAKERVN  300
MDKMAGMSQP SRPSAFYSNG SVNSSDLSKG NSAIQAI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.258011e-102bud| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00137531001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892180.0AC189218.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010F13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013741035.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A078CZU50.0A0A078CZU5_BRANA; BnaA03g34140D protein
STRINGfgenesh2_kg.3__1788__AT3G16350.11e-170(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93132735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-161MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]