PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00137411001
Common NameGSBRNA2T00137411001, LOC106424466, LOC106439519, LOC106439524
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 365aa    MW: 39799.5 Da    PI: 9.7385
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00137411001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.37e-13290340555
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                          +r+rrk+kNRe+A rsR+RK+a++ eLe ++++L++ N++L+ +  e+ ++
  GSBRNA2T00137411001 290 RRQRRKIKNRESAARSRARKQAYTLELEAEIEKLKKVNQELQRKQAEMMEM 340
                          69*************************************998766665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-10286347IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.726288339IPR004827Basic-leucine zipper domain
PfamPF001701.4E-10290341IPR004827Basic-leucine zipper domain
CDDcd147077.36E-24290342No hitNo description
SuperFamilySSF579592.18E-9290339No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-12290339No hitNo description
PROSITE patternPS000360293308IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGTHINFNSL GGGGSYQMKP TDSPNPLARQ SSVYSLTFDE LQSTFGGPGK DLGSMNMDEL  60
LKSIWTAEEA QAMTSSAATA VAQHGGGNLQ RQGSLTLPRT ISQKTVDEVW KFLITKDGEM  120
GGSSNGESNA QQTLGEMKIE DFLFRAGVVR EDNNEFYGNN GSAEGLGFGF GQLNQNNISF  180
NGTNDSMILN QPPGSCLKVG GTTQHQRMPQ TIFPKQTNVE FAASVCMVNK GFTGAVNNDN  240
GLASFRGEGV KIAATSPGTS SAENNSLSPV PYVLNRGRRS NTGVEKVIER RQRRKIKNRE  300
SAARSRARKQ AYTLELEAEI EKLKKVNQEL QRKQAEMMEM QKNEVNEPRG SKRQCLRRTL  360
TGPW*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, flowers and immatures siliques. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:11884679}.
Functional Description ? help Back to Top
Source Description
UniProtFunctions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:11884679, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16463099}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00137411001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt, abscisic acid (ABA) and cold. {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9719741e-110JQ971974.1 Eutrema salsugineum abscisic acid responsive elements-binding factor 4 (ABF4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013736445.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_013736446.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_022572176.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_022572177.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_022572178.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_022572179.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 7
SwissprotQ9M7Q21e-172AI5L7_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLA0A3P6A4B40.0A0A3P6A4B4_BRACM; Uncharacterized protein
STRINGBra001742.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.11e-161ABRE binding factor 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Gao S, et al.
    ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis.
    Mol Plant, 2016. 9(9): p. 1272-1285
    [PMID:27373216]
  3. Fernando VCD,Al Khateeb W,Belmonte MF,Schroeder DF
    Role of Arabidopsis ABF1/3/4 during det1 germination in salt and osmotic stress conditions.
    Plant Mol. Biol., 2018. 97(1-2): p. 149-163
    [PMID:29680877]
  4. Muñiz García MN,Cortelezzi JI,Fumagalli M,Capiati DA
    Expression of the Arabidopsis ABF4 gene in potato increases tuber yield, improves tuber quality and enhances salt and drought tolerance.
    Plant Mol. Biol., 2018. 98(1-2): p. 137-152
    [PMID:30143991]