PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00136989001
Common NameGSBRNA2T00136989001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 384aa    MW: 43129.6 Da    PI: 9.4398
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00136989001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.58e-10263303545
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                          k ++r+ +NRe Arrs +R  + i +Leekv++Le+e  +L
  GSBRNA2T00136989001 263 KYAKRMLSNREGARRSVKRTAQHILNLEEKVQTLEKEGVTL 303
                          779*********************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-8259323IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.7E-7261336No hitNo description
PROSITE profilePS502178.611261324IPR004827Basic-leucine zipper domain
PfamPF001704.0E-7263304IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.02E-6264310No hitNo description
CDDcd147022.30E-7266313No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MDRQAKNVPF QTSFVLSTHC PCPPSGQNRG SMPPPRRSSL PPLPPKRPTT ARRHQQVGLQ  60
NFTGPRLLPP QSPVFRSWTP MSSPAPSSSF QYFQPAPPVA YHNAALPPRP PTTSVSARGS  120
AYSGNDSAVF PSMDAMKMIY PEPIEMPVGV NYSKEGHGEP TGFMDQQVYM DLDEIFDFST  180
KDDDVARIGS GSSENNKRNA GVKKRAAPSR KTRRKSVSPS VDCNNLNNWK SSVAIEKGMF  240
TESQMNEIAR SKTLQKYVVT DPKYAKRMLS NREGARRSVK RTAQHILNLE EKVQTLEKEG  300
VTLTVHTSFA EKKKLGLEEE NKQLRIRLQE IQDQSKRANE INWVKQKGTE EVFPDWDTTM  360
DEFLLEQLNE LNEEPETNNC GFE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00136989001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894800.0AC189480.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB082F21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013601787.10.0PREDICTED: probable transcription factor PosF21
TrEMBLA0A3P6GF710.0A0A3P6GF71_BRAOL; Uncharacterized protein
STRINGBra031173.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2154335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-15bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]