PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00136988001
Common NameGSBRNA2T00136988001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 373aa    MW: 41307.3 Da    PI: 10.2699
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00136988001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.63.6e-10243301563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          kr +r+  NR +A rs  R  ++i++Le kv++L+ e ++L   l +l+     l++++
  GSBRNA2T00136988001 243 KRVKRMLANRASAARSKDRETKYIAQLEHKVQTLQIETTTLSAHLTHLQRDNMGLQNQN 301
                          999********************************************998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-12239303IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.3E-9241302No hitNo description
PROSITE profilePS5021710.151241304IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.14E-10243299No hitNo description
PfamPF001707.9E-9243301IPR004827Basic-leucine zipper domain
CDDcd147033.82E-17244295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MQRPNSSSSS LNPSPIRFPV PFTGNRVGAP PPPPIPPTFQ PKHSFPAAAV EERTGAGFSP  60
SLPPSPFTMY HSTSRVVAGG SGNLPPRKTS HRRSNSDHTF VFSSMSPSKS LERPVSGCGE  120
VSDWSKLVKE EERRTLSEGY DDALRAYMRL DQIDAESSRG RTRKMTNGGS TSGDSEGESN  180
VKRRAGGDIS PTSRHYRSVS VDSCCFREGA YSVGFGKYEF SAADMKKIAA DEKLAGIVMA  240
DPKRVKRMLA NRASAARSKD RETKYIAQLE HKVQTLQIET TTLSAHLTHL QRDNMGLQNQ  300
NSELKFRLQS MERQTQLRNA LSEKLTEEVQ RLRLVIGVPN RSESNISNAS LTPEMFQQQL  360
RISQLQHPHY NE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00136988001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894800.0AC189480.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB082F21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603790.10.0PREDICTED: transcription factor RF2b-like
TrEMBLA0A0D3DW910.0A0A0D3DW91_BRAOL; Uncharacterized protein
STRINGBo8g101920.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2035456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.11e-124bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]