PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00136609001
Common NameGSBRNA2T00136609001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 291aa    MW: 33988.5 Da    PI: 6.2963
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00136609001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.19.5e-2157115356
                          --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                          +R+++t+eq+ +Lee++ + +r+p++++++e+A+kl    +++ ++V++WFqN++ +e+
  GSBRNA2T00136609001  57 SRWNPTPEQTMVLEEVYSSgTRTPTTQQIQEIASKLqkygRIEGKNVFYWFQNHKSRER 115
                          7*****************99*************************************98 PP

2Wus_type_Homeobox109.71.7e-3556117364
    Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                          ++RW+PtpeQ ++Lee+y+sG+rtP++++iq+i+++L++yG+ie+kNVfyWFQN+k+Rer k
  GSBRNA2T00136609001  56 HSRWNPTPEQTMVLEEVYSSGTRTPTTQQIQEIASKLQKYGRIEGKNVFYWFQNHKSRERLK 117
                          68**********************************************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.25652117IPR001356Homeobox domain
SuperFamilySSF466891.07E-1253116IPR009057Homeodomain-like
SMARTSM003897.0E-554121IPR001356Homeobox domain
PfamPF000462.7E-1857115IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-857115IPR009057Homeodomain-like
CDDcd000861.83E-558115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGKQKLVSNI YISLGYNKDL TSHSLAHHCN MNDIRNDEQI ITGSAGEPKE REKYMHSRWN  60
PTPEQTMVLE EVYSSGTRTP TTQQIQEIAS KLQKYGRIEG KNVFYWFQNH KSRERLKRRR  120
GDQQGVTTIS NVHEETLRKD NVIVDTANKD SSSVSRRRGD HRVIHTSTCL SPSPTHPQKN  180
SIDDGKREEY KRGLEEEKET TSQNQIHPSN TSDFNYHLIT ASKPSQEEEQ QYKLNDDEEE  240
EEEETRKSRT LDLFPVIENQ EIIGFEEKNT KPNQLYCNYC YYYEFMPLMN *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00136609001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013709790.10.0PREDICTED: WUSCHEL-related homeobox 6-like
TrEMBLA0A078CWZ40.0A0A078CWZ4_BRANA; BnaC08g39150D protein
STRINGBra026791.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133691828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.14e-47WOX family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]