PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00136356001
Common NameGSBRNA2T00136356001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NAC
Protein Properties Length: 555aa    MW: 62081.9 Da    PI: 4.2249
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00136356001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.8e-5391361128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgk
  GSBRNA2T00136356001   9 LAPGFRFHPTDEELVRYYLKRKVCNKPFNF-DAISVTDIYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGK 97 
                          579**************************9.99**************95347777888******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d+e+ + ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  GSBRNA2T00136356001  98 DREIRN-GSRAVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                          *****9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-617159IPR003441NAC domain
PROSITE profilePS5100558.1089159IPR003441NAC domain
PfamPF023654.8E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MGRGSVTSLA PGFRFHPTDE ELVRYYLKRK VCNKPFNFDA ISVTDIYKSE PWDLPDKSKL  60
KSRDLEWYFF SMLDKKYSNG SKTNRATEKG YWKTTGKDRE IRNGSRAVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLTDEE LKRAGAPLDA FVLCRIFQKS GTGPKNGEQY GAPYLEEEWE  180
EDKMTFVPEQ DALSEGLAVD DDVYVDIDEI DEKPENLVVY DAIPVQTNYC HGESSNNAES  240
GNYEDSGNYV VDSGGYIEQP TETFEEDQKP IIRDCSIQPC SLYPVEQIGC GVEDENAVNL  300
ETSNNNVFVA DPCYSDIPIE ADYLPDEPFM DPSNNLPLCD DLYLETNDLS GGGLQDDFNF  360
EDYLNFFDDE EAQNLTLDVS QLLGSQDAPP EQEGLDQKPS PEELEKEVVE KKESGEGSSS  420
KQDADVTDFD SDSKYPFLKK SSHMFGVPPS FASQFQTKDA AIRLHAAQSS GSVHVTAGMI  480
RISNMTPAVD SDMGWAYDKS GDLNVVLSFG LVQRDDAMSK TGGISATRAM LIFLCLWVLL  540
LSVSFKIVTM VSAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-46816516171NO APICAL MERISTEM PROTEIN
1ut4_B1e-46816516171NO APICAL MERISTEM PROTEIN
1ut7_A1e-46816516171NO APICAL MERISTEM PROTEIN
1ut7_B1e-46816516171NO APICAL MERISTEM PROTEIN
3swm_A1e-46816519174NAC domain-containing protein 19
3swm_B1e-46816519174NAC domain-containing protein 19
3swm_C1e-46816519174NAC domain-containing protein 19
3swm_D1e-46816519174NAC domain-containing protein 19
3swp_A1e-46816519174NAC domain-containing protein 19
3swp_B1e-46816519174NAC domain-containing protein 19
3swp_C1e-46816519174NAC domain-containing protein 19
3swp_D1e-46816519174NAC domain-containing protein 19
4dul_A1e-46816516171NAC domain-containing protein 19
4dul_B1e-46816516171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.78980.0flower| root| seed
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root meristem (Ref.1). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00136356001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6413560.0KP641356.1 Brassica napus NAC transcription factor 78.1 (NAC78.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013732903.20.0NAC domain-containing protein 78
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A120H3900.0A0A120H390_BRANA; NAC transcription factor 78.1
STRINGBra009456.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  4. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  5. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  6. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  7. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]