PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00136321001
Common NameGSBRNA2T00136321001, LOC106419034
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 308aa    MW: 33551.2 Da    PI: 7.0084
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00136321001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.88.1e-071812261863
                          HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          +rsR RK+++i+eLe++v  L+a   +L  ++ +l ++ a+l  e+
  GSBRNA2T00136321001 181 QRSRVRKLQYIAELERRVSMLQAVEADLSVRVASLLQTRATLSLEN 226
                          79******************************99999999988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147036.01E-15175220No hitNo description
Gene3DG3DSA:1.20.5.1708.8E-6181233No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSRPGQLPPR CPIPKKLSLN PYADTFYSSS SPVESYISHH HKSSSPAQDS TLEEQPAWLD  60
ELLGDKTDCG GPSPLRRSAS DSVVLLGDIS ADFAGFNQSE DEESLSSEAC GELESACVYG  120
PNSPRAKNSS SFSDSTIASA FSEYGSQKAP QNADDTVKGS ICHPHEAENA CGSNAKRNPG  180
QRSRVRKLQY IAELERRVSM LQAVEADLSV RVASLLQTRA TLSLENSQMK QQMAILKQDK  240
LIREGEYLLL KKEAQRLNSR LRNFGSNNNN NNNRLARSYS AGSSIGPRTG SSPLDWNLLD  300
LTKLNLN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00136321001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013715234.10.0basic leucine zipper 34
RefseqXP_013715235.10.0basic leucine zipper 34
TrEMBLA0A397XNW50.0A0A397XNW5_BRACM; Uncharacterized protein
STRINGBra009426.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1364279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.24e-17bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]