PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00136149001
Common NameGSBRNA2T00136149001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 335aa    MW: 37544.7 Da    PI: 4.7326
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00136149001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.8e-154388148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
  GSBRNA2T00136149001 43 RGEFSYEEEQIIIMLHASRGNK-WSVIARHLP-KRTDNEVKNYWNTHL 88
                         899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.12E-163394IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-243592IPR009057Homeodomain-like
PROSITE profilePS5129423.5343892IPR017930Myb domain
SMARTSM007172.2E-134290IPR001005SANT/Myb domain
PfamPF002491.9E-134388IPR001005SANT/Myb domain
CDDcd001672.17E-104588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MILKALTTSL FITPATVFKG CCWTCVGQEL GLYFTYLKPD IKRGEFSYEE EQIIIMLHAS  60
RGNKWSVIAR HLPKRTDNEV KNYWNTHLKK RLIDQGIDPL THKPLASSPN PATTRTSEGQ  120
DDSNPSNLDE QSQSGSMSPK YLPISSSSCN LQKMSNSDET TRNNGSLSSK KCRFKKSSST  180
SKLLNKVATK ASSIGNMVSA SVEGSLIRST ILSPCLNDVF SETSQFQMDE FDPFSHSSEQ  240
HITDHMKEDI NMDFDLKNSE FDFSQFIEQF SNIEAEKANA IGGYNQDLLL SDVSSTSVDE  300
DNIMQNITGW SNYLVDDSDF PYDTNQDFDD KNFI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00136149001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009122913.10.0PREDICTED: transcription factor MYB29
SwissprotQ9FLR11e-137MYB29_ARATH; Transcription factor MYB29
TrEMBLA0A078C1K10.0A0A078C1K1_BRANA; BnaA10g23980D protein
STRINGBra005949.1-P1e-138(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07690.11e-112myb domain protein 29
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]