PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00136106001
Common NameGSBRNA2T00136106001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 150aa    MW: 17425.1 Da    PI: 9.4759
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00136106001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.96.8e-1152110563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          k+ +r  +NR+AA++sR +K+++i+ L +k+  L  + ++L++++e+ +++ + l+ e+
  GSBRNA2T00136106001  52 KKLKRIVSNRVAAQKSRWKKLQYIDDLVKKSRDLNWQVSMLRSQVEMASEQKQCLEREK 110
                          8999*******************************************999988877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-1048112IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.95650113IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.5E-1152107No hitNo description
SuperFamilySSF579595.98E-1152106No hitNo description
PfamPF001701.1E-852110IPR004827Basic-leucine zipper domain
CDDcd147031.35E-1053104No hitNo description
PROSITE patternPS0003605570IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSEPSFPVPT SFQVSNDGSQ VEEKKTGYLN YEVEPGFTIR LRQNIDPAMD PKKLKRIVSN  60
RVAAQKSRWK KLQYIDDLVK KSRDLNWQVS MLRSQVEMAS EQKQCLEREK MELKECMAGW  120
IQRFISDQGE IEANTAEIER LKKKMAHMI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00136106001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610800.11e-108PREDICTED: basic leucine zipper 19
RefseqXP_013746785.11e-108basic leucine zipper 19
TrEMBLA0A397XVW41e-106A0A397XVW4_BRACM; Uncharacterized protein
STRINGBo9g175190.11e-107(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144181821
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07160.18e-60bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]