PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00135931001
Common NameGSBRNA2T00135931001, LOC106419467
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 365aa    MW: 41817.3 Da    PI: 7.1198
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00135931001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.91.6e-1178110335
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekv 35 
                          ++k +rr+++NReAA++sR+RKka++++Le+  
  GSBRNA2T00135931001  78 PDKTQRRLAQNREAAKKSRLRKKAYVQQLETSR 110
                          689**************************9854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-476138IPR004827Basic-leucine zipper domain
PfamPF001703.4E-978108IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.63478120IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-880121No hitNo description
SuperFamilySSF579599.38E-780120No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
PfamPF141444.5E-30166241IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MNTTTSTHFV PPTRFEIYDP LNQIGTMWEE SFKNNGGGFY TPNSIIIPTN QKPYSLSEDG  60
TEGTPHKFDQ EASTSRHPDK TQRRLAQNRE AAKKSRLRKK AYVQQLETSR LKLIHLEQEL  120
DRARQQGFYA SNRVDTNALS FSDNMCSGIV AFEMEYGHWV EEQNRQISEL RTVLNGQVSD  180
IELRLLVDNA MKHYFQLFRM KSAAAKLDVF YIMSGMWKTS AERFFLWIGG FRPSELLKVL  240
LPHFDPMMDQ QVLDVCNLRQ SCQQAEDAVS QGMEKLQHTL AESVAAGELG EGSYVPQITS  300
AMERLEALVS FVNQADHLRH ETLQQMHRIL TTRQAARGLL ALGEYFQRLR ALSSSWETRQ  360
REPT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots. {ECO:0000269|PubMed:8628224}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00135931001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530850.0AK353085.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-10-F22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009122096.10.0PREDICTED: transcription factor TGA4
RefseqXP_009122097.10.0PREDICTED: transcription factor TGA4
RefseqXP_013715712.10.0transcription factor TGA4
RefseqXP_013715714.10.0transcription factor TGA4
RefseqXP_022549492.10.0transcription factor TGA4
RefseqXP_022569128.10.0transcription factor TGA4-like
RefseqXP_022569129.10.0transcription factor TGA4-like
RefseqXP_022569130.10.0transcription factor TGA4-like
SwissprotQ391620.0TGA4_ARATH; Transcription factor TGA4
TrEMBLA0A3P6D6I90.0A0A3P6D6I9_BRACM; Uncharacterized protein
TrEMBLQ4ABR50.0Q4ABR5_BRARP; 80A08_2
STRINGBra009063.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29762766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.20.0TGACG motif-binding factor 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]