PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00135290001
Common NameGSBRNA2T00135290001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 121aa    MW: 14179.9 Da    PI: 9.9759
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00135290001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.26.2e-124096258
                         XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58
                          + k+ rrk +NRe+ArrsR RK+  + eL      L +eNk L +el++ ++ +++
  GSBRNA2T00135290001 40 DDEKKRRRKVSNRESARRSRMRKRRHLNELWSMLVHLINENKCLFDELSRANEGYEN 96
                         56799********************************************99988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.9E-934115No hitNo description
SMARTSM003384.2E-1339103IPR004827Basic-leucine zipper domain
PfamPF077161.1E-94089IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.47341104IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.38E-104393No hitNo description
PROSITE patternPS0003604661IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MDGFVYNLPG ANPNQQFFNN QVPLVNLPAT SDESNRSAED DEKKRRRKVS NRESARRSRM  60
RKRRHLNELW SMLVHLINEN KCLFDELSRA NEGYENVVEE NKKLREENSK LRKMIGEIGF  120
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14247KKRRRK
24563RRKVSNRESARRSRMRKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00135290001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619983.15e-82PREDICTED: basic leucine zipper 43
SwissprotQ9CA465e-57BZIP8_ARATH; Basic leucine zipper 8
TrEMBLA0A0D3AP401e-80A0A0D3AP40_BRAOL; Uncharacterized protein
TrEMBLA0A3N6T1911e-80A0A3N6T191_BRACR; Uncharacterized protein
STRINGBo2g061410.12e-81(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150351619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68880.18e-38basic leucine-zipper 8
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]