PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00134526001
Common NameGSBRNA2T00134526001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TCP
Protein Properties Length: 245aa    MW: 27341.3 Da    PI: 6.9122
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00134526001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP89.57.6e-2838107372
                  TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                          g+kdrhsk++T +g+RdRR+Rlsa++a++++dLq++LG+ ++sk i+WLl++a+  +  l+ +++++  +
  GSBRNA2T00134526001  38 GGKDRHSKVCTVRGLRDRRIRLSATTAIQLYDLQERLGLSQPSKVIDWLLEAAQNDVAMLPPLQFPPGFH 107
                          68************************************************************96666522 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.0E-2639111IPR005333Transcription factor, TCP
PROSITE profilePS5136926.6533997IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MRTNSMGIKQ EGDNHYQATS LSSLRQNPRI VRASRIFGGK DRHSKVCTVR GLRDRRIRLS  60
ATTAIQLYDL QERLGLSQPS KVIDWLLEAA QNDVAMLPPL QFPPGFHPNL TAAAGESFPG  120
YFESFDLGSC SSRTDTTLQR EGLNLESHGF DIDHHFFSNS NHRDKLYFPS SSSCHYNLEQ  180
LQQSLLDQSG NVTVALSNNN HLNPSAVETM SSLFPRYPLF HEGGDQLQLF SSNSNSSKQT  240
DHVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A9e-174498155Putative transcription factor PCF6
5zkt_B9e-174498155Putative transcription factor PCF6
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:25378179}.
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, roots, stems, buds, flowers and siliques. {ECO:0000269|PubMed:17307931}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00134526001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410040.0AC241004.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB026J02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626503.10.0PREDICTED: transcription factor TCP17
RefseqXP_013626504.10.0PREDICTED: transcription factor TCP17
RefseqXP_013626505.10.0PREDICTED: transcription factor TCP17
SwissprotQ9LEZ98e-92TCP17_ARATH; Transcription factor TCP17
TrEMBLA0A0D3B0821e-179A0A0D3B082_BRAOL; Uncharacterized protein
TrEMBLA0A3P6A8B21e-179A0A3P6A8B2_BRAOL; Uncharacterized protein
STRINGBo3g004670.11e-180(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35762763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08070.14e-83TCP domain protein 17
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]