PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00134120001
Common NameGSBRNA2T00134120001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 568aa    MW: 62010.9 Da    PI: 6.8812
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00134120001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.1e-152771147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         r rWT++E++++++a +++G   W +I +++g ++t+ q++s+ qk+
  GSBRNA2T00134120001 27 RERWTEDEHDRFLEALRLYGRA-WLRIQEHIG-TKTAVQIRSHAQKF 71
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.21E-162177IPR009057Homeodomain-like
PROSITE profilePS5129418.7352276IPR017930Myb domain
TIGRFAMsTIGR015573.3E-162574IPR006447Myb domain, plants
SMARTSM007179.9E-122674IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-72767IPR009057Homeodomain-like
PfamPF002491.6E-122770IPR001005SANT/Myb domain
CDDcd001679.00E-92972No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MDTNTSDGPG EELLTKARKP YTITKQRERW TEDEHDRFLE ALRLYGRAWL RIQEHIGTKT  60
AVQIRSHAQK FFTKLEKEAE AKGIKALDIE IPPPRPKRKP NVPYPRKPGP SSSQCNQPQV  120
FLDLEKVPIS EKTSTGKENQ EENCSGVNKY PLPNKVVTPG KLKTFMESSD PSLRKASADN  180
ETSKASNVDN NMVHKENKDR DDDGLHSARH HPATKTSPSA ATTTTSHQAF PAFSFCSFLH  240
MSSTFSNLIM STLLQNPAVH AAATFAASAL PFTTNAGASS TQMSSSPPTI AAIVAATVAA  300
ATAWWASHGL LPTPVPLPAV SVPTPAAMDN VRNDQLEKQS TAFQEQNMAS KSPDSSSDDS  360
EETGITKLKA DGDKEEVVAA LQDSNVSHKK NPVDRSSCGS NTPSGSDVET DALEKEKEAD  420
ANQPSVIELS NRRSKIRDNN NNQTTDSWKE VSQGGRIAFQ ALFARERLPQ SFSPPQAAED  480
LNGKQISDTS MPLAHNNLNK IQDSCKADQE SAVDEEPGKS LKMRETGFKP YKRCSMEAKE  540
SQVGNANNHN DEKVCCKRLR LEAEAST*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00134120001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3527641e-102AK352764.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-N03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013630031.10.0PREDICTED: protein LHY-like isoform X1
SwissprotQ6R0H10.0LHY_ARATH; Protein LHY
TrEMBLA0A078CV920.0A0A078CV92_BRANA; BnaC03g00040D protein
STRINGBra030496.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55762645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.40.0MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]