PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00133705001
Common NameGSBRNA2T00133705001, LOC106352177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 203aa    MW: 22553.9 Da    PI: 8.6142
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00133705001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.32.2e-191054246
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                          ien++ r+ tf kR+ gi+KKA ELS+LCd+ +avi+ s+ + +
  GSBRNA2T00133705001 10 YIENETSRKATFRKRKGGIMKKALELSTLCDVPIAVIVQSEYNSV 54
                         59**************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.801161IPR002100Transcription factor, MADS-box
SMARTSM004322.4E-25160IPR002100Transcription factor, MADS-box
CDDcd002662.38E-24286No hitNo description
SuperFamilySSF554551.7E-24296IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-14323IPR002100Transcription factor, MADS-box
PfamPF003194.1E-181153IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-142338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-143859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MTRNRVKMAY IENETSRKAT FRKRKGGIMK KALELSTLCD VPIAVIVQSE YNSVPEVFPP  60
SRQAMGNVVA RWDSLPLVDK TKKMMNQEQF IQQRITKATE SCKKVAKENK ELAMKEVMYD  120
CLRGDTAPCD LGEGELRDLG GVIDQYIKGL NRRIQVLMRD HASSSTSVVP DADVATSVAM  180
PTAEMGSSSN VKDFDLNQTQ SE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00133705001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013647300.21e-149agamous-like MADS-box protein AGL80
TrEMBLA0A0D3DCK81e-149A0A0D3DCK8_BRAOL; Uncharacterized protein
TrEMBLA0A3P6EH821e-149A0A3P6EH82_BRAOL; Uncharacterized protein
STRINGBo7g095090.11e-149(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.11e-59M-type_MADS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]