PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00133246001
Common NameGSBRNA2T00133246001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 318aa    MW: 36891.8 Da    PI: 8.6641
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00133246001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS319.47.4e-98230475374
                 GRAS  75 seelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetg 162
                          ++ l+a+klf++v+Pi+   +++aN+ I+e + +++++H+iDf++ +G+QWp+Ll aL++Rp+gpp+lR+Tg++ p+sg   ++++eetg
  GSBRNA2T00133246001   2 VDILKAYKLFVHVCPIYVADYFAANKSIYELALNSTKLHVIDFGVLYGFQWPCLLLALSKRPGGPPKLRVTGIELPQSGfrPSDRVEETG 91 
                          57899*************************************************************************9*********** PP

                 GRAS 163 erLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnses 252
                          +rL++f++ ++vpfefn+ +ak++e+++l+e+ + pgE+++Vn++++l++++de+vsl+s+rd+vLkl++++sP+++v++e +  +ns+ 
  GSBRNA2T00133246001  92 RRLKRFCDMFNVPFEFNF-IAKKWESITLDEITIIPGETTVVNCIHRLQYTPDETVSLDSPRDTVLKLFRDISPDLFVFAEINGTYNSPF 180
                          ******************.7********************************************************************** PP

                 GRAS 253 Flerflealeyysalfdsleaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakll 340
                          F++rf eal ++s+lfd++++++ +e+  ++r+ +Erell r++++v++ egaer++r et+++Wr rl +aGF+p+ +s ++ k ak +
  GSBRNA2T00133246001 181 FMTRFKEALFHFSSLFDMFDTTIQAEDeyKNRALLERELLVRDAMSVISSEGAERFARPETYKQWRVRLLRAGFRPAMVSREILKGAKEI 270
                          **********************99998899************************************************************ PP

                 GRAS 341 lrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          +rk + + + ++ + +++++gWk+r ++++S+W+
  GSBRNA2T00133246001 271 VRKRYHKDFLIDGDGNWMLQGWKGRVIYAFSCWK 304
                          *****888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.5661284IPR005202Transcription factor GRAS
PfamPF035142.5E-952304IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MVDILKAYKL FVHVCPIYVA DYFAANKSIY ELALNSTKLH VIDFGVLYGF QWPCLLLALS  60
KRPGGPPKLR VTGIELPQSG FRPSDRVEET GRRLKRFCDM FNVPFEFNFI AKKWESITLD  120
EITIIPGETT VVNCIHRLQY TPDETVSLDS PRDTVLKLFR DISPDLFVFA EINGTYNSPF  180
FMTRFKEALF HFSSLFDMFD TTIQAEDEYK NRALLERELL VRDAMSVISS EGAERFARPE  240
TYKQWRVRLL RAGFRPAMVS REILKGAKEI VRKRYHKDFL IDGDGNWMLQ GWKGRVIYAF  300
SCWKPAEKLT RDDHIII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-32830480375GRAS family transcription factor containing p
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00133246001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013714537.10.0PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 11
SwissprotQ9LTI50.0SCL11_ARATH; Scarecrow-like protein 11
TrEMBLA0A078CTS30.0A0A078CTS3_BRANA; BnaC09g34770D protein
TrEMBLA0A0D3ECS50.0A0A0D3ECS5_BRAOL; Uncharacterized protein
STRINGBra002564.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36462561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59450.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]