PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00133089001
Common NameGSBRNA2T00133089001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ARF
Protein Properties Length: 760aa    MW: 83959.3 Da    PI: 6.8229
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00133089001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.46.6e-24175276199
                          EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                          f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+++ L +gD v+F  
  GSBRNA2T00133089001 175 FCKTLTASDTSTHGGFSVPRRAAEDCfapldyK-QQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKSLVSGDAVLFL- 262
                          99****************************963.3445679************************************************. PP

                          -SSSEE..EEEEE-S CS
                   B3  85 dgrsefelvvkvfrk 99 
                           +++++el+++++r+
  GSBRNA2T00133089001 263 -RDENGELRLGIRRS 276
                          .5689999****986 PP

2Auxin_resp120.51.2e-39300381182
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                          +a+a+s+ks+F+v+Y+Pra++seFv+++ek+ +++k+++ +G+Rf+m+fe++ds+err++G+v+gv d+dp+rWpnSkWr+L
  GSBRNA2T00133089001 300 VANAVSNKSMFDVFYSPRATHSEFVIPYEKYITSIKNPIGIGTRFRMRFEMDDSPERRCAGVVTGVCDMDPYRWPNSKWRCL 381
                          689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.6E-40166287IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-42169291IPR015300DNA-binding pseudobarrel domain
CDDcd100173.76E-21173275No hitNo description
SMARTSM010193.7E-23175277IPR003340B3 DNA binding domain
PfamPF023628.6E-22175276IPR003340B3 DNA binding domain
PROSITE profilePS5086313.422175277IPR003340B3 DNA binding domain
PfamPF065071.7E-33300381IPR010525Auxin response factor
SuperFamilySSF542773.63E-10635713No hitNo description
PROSITE profilePS5174522.181638720IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MEFDLNTEFA EVEEEENDEG GGARVEKGKR LGVLPSSSSS CSSRSSSSSS SSTTASASSI  60
YSELWHACAG PLTSLPKKGN VVVYFPQGHL EQGVMVSYSS PLDVPKLDLS PQIFCRVAAV  120
HLLANKETDE VYTQVTLLPL QELSMLNGEG KEVKELGGDE EKNGSSSVKK TPHMFCKTLT  180
ASDTSTHGGF SVPRRAAEDC FAPLDYKQQR PSQELIAKDL HGVEWKFRHI YRGQPRRHLL  240
TTGWSIFVSQ KSLVSGDAVL FLRDENGELR LGIRRSARPR NGLPDSIIQK YSSSSILSLV  300
ANAVSNKSMF DVFYSPRATH SEFVIPYEKY ITSIKNPIGI GTRFRMRFEM DDSPERRCAG  360
VVTGVCDMDP YRWPNSKWRC LLVRWDESFM SDHQERVSPW EIDPSGSLPP LSIQSSPRPK  420
RPWAGLLGTT TPQGNPITAE RGGFLDFEES VRPSKVLQGQ ENTGSASSSP LQGFDVMNRR  480
ILDFAGMQQS HANPVLLSGR VKDRFGEFVD STSLDLDRFP RVLQGQEICS LRSFPQIAGF  540
TPASASGSPN PFAYQANKSS FYPLASQGIR SSHIPYQSPY NAGDKSSSRK FDAQREGGLP  600
KNVPFKVNMN ASTTGCKLFG FSLPVETPAS NQQSSSKRIC TKVHKQGSLV GRAIDLSRLN  660
GYNDLLTELE RLFNMEGLLR DPEKGWRILY TDSENDMMVV GDDPWHDFCS VVLKIHLYTK  720
EEVENGNDDN RSCLEQAALM MEASKSSSVS QPDSSPTGH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-112454074357Auxin response factor 1
4ldy_B1e-112454074357Auxin response factor 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00133089001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794640.0JN979464.1 Brassica rapa subsp. pekinensis auxin response factor 4 (ARF4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612784.10.0PREDICTED: auxin response factor 4 isoform X2
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A0D3ED440.0A0A0D3ED44_BRAOL; Auxin response factor
STRINGBo9g143570.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  4. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  5. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  6. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  7. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]