PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00132982001
Common NameGSBRNA2T00132982001, LOC106436389
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 434aa    MW: 48947.8 Da    PI: 9.7447
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00132982001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.51.7e-09132174346
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           WT+eE ++l ++++++  + ++ Ia ++++ Rtl+++k+r+++
  GSBRNA2T00132982001 132 VWTKEETDQLFELCERFDLR-FTVIADRFPLSRTLEELKDRYYS 174
                          6*******************.*********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162822.5E-30105179IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007172.7E-9129178IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-7129182IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-7132177IPR009057Homeodomain-like
CDDcd116584.42E-18133175No hitNo description
PfamPF054992.3E-6310373IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MGGTDAKDIL GLPKTPLSLT QEKKSRPQKE SHRKPDGISR EVYALTGGVA PLMPSIDVTQ  60
LKRPPPPDEK VAWQWLPVKS SARKDDLQLY HWVRVVNDIP PSGDYSFAKY NKSVDVLKYT  120
DDEYENHLTD PVWTKEETDQ LFELCERFDL RFTVIADRFP LSRTLEELKD RYYSVTRALL  180
RARAQSPAEL ANHPLIKEPY DMTRDRERKR ALSMVLSQSR HQEKKDAEIL AEAKRITEMR  240
LAARRAAEPD VPANENIGSV SPSSNSQLPA TAVAPSTLTM ADYASTLASL RMLHVYLRTY  300
GLEQMVQAAS SAVGLRTIKR VEQTLQDLGV NLKPKVPTKT VCDEHLELRK EILTLLNLQK  360
QLQYKESEGS SHREGTYGAM PDTPKDRVFA SEPFGFGAER PIKKEPKRKG PGRQSDTPSP  420
AHKRPRKLKA SDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A4e-19104184488DNA methyltransferase 1-associated protein 1
4iej_A4e-19104184488DNA methyltransferase 1-associated protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.215980.0vegetative meristem
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00132982001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530190.0AK353019.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-19-J15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142553.10.0PREDICTED: DNA methyltransferase 1-associated protein 1-like
RefseqXP_013732808.10.0PREDICTED: SWR1-complex protein 4-like
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLA0A078CTM90.0A0A078CTM9_BRANA; BnaA05g00690D protein
STRINGscaffold_403698.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85432435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]