PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00132723001
Common NameGSBRNA2T00132723001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 281aa    MW: 31505.8 Da    PI: 7.3702
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00132723001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.68.5e-11148191548
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                          kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  GSBRNA2T00132723001 148 KRVKRILANRQSAQRSRVRKLQYITELERSVTSLQAEVSVLSPR 191
                          8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-12144208IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.588146209IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.9E-13148199No hitNo description
PfamPF001703.0E-9148191IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.34E-11148202No hitNo description
CDDcd147031.37E-22149199No hitNo description
PROSITE patternPS000360151166IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MAQLPPKIPN MTPHWPDFSS QNLTATASTA VQNPSWVDEF LDFSACRRGN HRRSISDSIA  60
FLEAPFVRGH GSNQNDHHFD KFDDEQFMSM FKDDNDLHNN PSHNNNNAGT TGSSSNTSTF  120
QCKTEPEDGT ASNNNSGDSS VTRILDPKRV KRILANRQSA QRSRVRKLQY ITELERSVTS  180
LQAEVSVLSP RVAFLDHQRL LLNVDNSSLK QRIAALAQDK IFKDAHQEAL KREIERLREV  240
YQQQSLKKME NGNHSQATGT GANSAVDIKP SNEKEELFNV *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.110510.0flower| microspore-derived embryo
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vascular tissues of leaves, stems and siliques, anthers, filaments, tapetum, mature pollen grains, pistil vascular tissues and papillar cells, and funiculi. {ECO:0000269|PubMed:19449183}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in the sporophytic control of cell wall patterning and gametophytic control of pollen development. May play a role in the control of metabolic pathways regulating cellular transport and lipid metabolism. {ECO:0000269|PubMed:17719007, ECO:0000269|PubMed:19449183}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00132723001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1553370.0AC155337.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH117N09, complete sequence.
GenBankAC1892200.0AC189220.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010H06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013747771.10.0basic leucine zipper 34
SwissprotF4IN231e-144BZP34_ARATH; Basic leucine zipper 34
TrEMBLM4CKF41e-179M4CKF4_BRARP; Uncharacterized protein
STRINGBra004689.1-P1e-180(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.24e-92bZIP family protein
Publications ? help Back to Top
  1. Jiang J,Zhang Z,Cao J
    Pollen wall development: the associated enzymes and metabolic pathways.
    Plant Biol (Stuttg), 2013. 15(2): p. 249-63
    [PMID:23252839]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  4. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]