PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00132433001
Common NameGSBRNA2T00132433001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 692aa    MW: 75640.1 Da    PI: 7.2533
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00132433001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-094104471954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  GSBRNA2T00132433001 410 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 447
                          554459******************************88 PP

2BELL123.49.1e-40269340172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqe+q+kkakL s+l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
  GSBRNA2T00132433001 269 ERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQI 340
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.7E-76189338IPR006563POX domain
PfamPF075263.1E-46195337IPR006563POX domain
PROSITE profilePS5007112.26388451IPR001356Homeobox domain
CDDcd000869.72E-13391452No hitNo description
SMARTSM003892.3E-9391455IPR001356Homeobox domain
SuperFamilySSF466895.99E-17392458IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-29394457IPR009057Homeodomain-like
PfamPF059202.9E-18408447IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MIMKHVHHQI SINPVYNSMA AYFHGNPPEI SAGTDGGLQT LILMNPTTYV PYTQQDDDSN  60
NSSNNNNNTN NNSFVFLDSH APPRNANQQF VGIPLSGHEA ASITAADNIS VLHGYPPRVQ  120
YSLYGSHQVD PTHHQAACET PRAQRGLSLT LSSQQQKQQH RQTLHHVGFG SGPGEDIRVG  180
SGSTASGVTN GIANLVSSKY LKAAQELLDE VVKADSNDIN TKSQLFSSKK GTSVTDTKAV  240
GESSTGAREG SDGGGEASGK RTVELGTAER QEIQMKKAKL SSMLHEVEQR YRQYHQQMQM  300
VISSFEQAAG IGSAKSYTSL ALKTISRQFR CLKEAIAGQI KAANKSLGEE DSVSGVGRFE  360
GSRLKFVDNH LRQQRALQQL GMIQHPSNNA WRPQRGLPER AVSVLRAWLF EHFLHPYPKD  420
SDKHMLAKQT GLTRSQVSNW FINARVRLWK PMVEEMYAEE MKEQGKNMGS MEKTPNLDEN  480
IDDSASKSTS NQEKIPMGGG GLDDYHLNPS HNGDLEGVTG MQGSPKRLRT SDDTMMQPIN  540
EGFSSNEKIT MKILEERQGI RSDGGYPFMG SFVQYQMDEM SRFNVAVSDQ ELLTQRFSGN  600
INGVSLTLGL PHCDSLSSTH HQGFMQTHHG IQIGRSVKIG ETEEYGNSAI NGGSGSAATA  660
HSSAAAAAAY NGMNIQNQKR YVAQLLPDFV A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A8e-17397454158Homeobox protein Meis1
4xrs_B8e-17397454158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.45240.0flower| leaf| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00132433001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013683591.10.0BEL1-like homeodomain protein 1
RefseqXP_022554766.10.0BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A3P6AJ120.0A0A3P6AJ12_BRAOL; Uncharacterized protein
STRINGBo3g029830.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]