PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00132295001
Common NameGSBRNA2T00132295001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 188aa    MW: 21872.3 Da    PI: 8.0098
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00132295001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.72.5e-41109186178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cqve+C+ad+s+ak+yh+rhkvCe+h+kapvv +sg  qrfCqqCsrfh+l+efDe+krsCrrrLa+hnerrrk+++
  GSBRNA2T00132295001 109 CCQVERCTADMSRAKQYHKRHKVCEFHAKAPVVRISGGYQRFCQQCSRFHDLREFDEAKRSCRRRLAGHNERRRKSTN 186
                          6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.7E-32103171IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.812107184IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.16E-36108185IPR004333Transcription factor, SBP-box
PfamPF031101.5E-31110183IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MSEILWSNNL STLRSFLTFV SGVLKFSSNV YFHIFSSCYI FHVREEESNI LKMSTRRSNA  60
EGKRSLREMS EEEEDTFEEE DGEEQEEEEA SEKKQKGKAT SSSSNSGVCC QVERCTADMS  120
RAKQYHKRHK VCEFHAKAPV VRISGGYQRF CQQCSRFHDL REFDEAKRSC RRRLAGHNER  180
RRKSTNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-38101183184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.135831e-139bud| seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00132295001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2411462e-95AC241146.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH072P15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626500.14e-93PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_013680760.14e-93PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_013744507.14e-93PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_013744508.14e-93PREDICTED: squamosa promoter-binding-like protein 3
SwissprotP930151e-59SPL3_ARATH; Squamosa promoter-binding-like protein 3
TrEMBLA0A078CU661e-135A0A078CU66_BRANA; BnaC03g18800D protein
TrEMBLA0A0D3B4R81e-135A0A0D3B4R8_BRAOL; Uncharacterized protein
STRINGAT2G33810.13e-57(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.13e-56squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]