PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00131848001
Common NameGSBRNA2T00131848001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 571aa    MW: 65513.3 Da    PI: 6.0495
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00131848001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.63.7e-1088131447
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                          +k  rr+++NReAAr+sR+RKka++++Lee   +L++  ++L k
  GSBRNA2T00131848001  88 DKMKRRLAQNREAARKSRLRKKAYVQQLEESRFKLSQLEQELEK 131
                          7999**************************88888887776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.3E-880164IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-780131No hitNo description
PROSITE profilePS502179.28987131IPR004827Basic-leucine zipper domain
PfamPF001705.5E-788131IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.09E-689131No hitNo description
PROSITE patternPS00036092107IPR004827Basic-leucine zipper domain
PfamPF141441.1E-28173247IPR025422Transcription factor TGA like domain
SuperFamilySSF465659.94E-22365443IPR001623DnaJ domain
Gene3DG3DSA:1.10.287.1101.9E-21367444IPR001623DnaJ domain
SMARTSM002711.9E-16373437IPR001623DnaJ domain
PROSITE profilePS5007617.801374445IPR001623DnaJ domain
CDDcd062574.68E-14375434IPR001623DnaJ domain
PfamPF002261.6E-19375442IPR001623DnaJ domain
PRINTSPR006251.5E-15376394IPR001623DnaJ domain
PRINTSPR006251.5E-15394409IPR001623DnaJ domain
PRINTSPR006251.5E-15417437IPR001623DnaJ domain
PROSITE patternPS006360422441IPR018253DnaJ domain, conserved site
PRINTSPR006251.5E-15463482IPR001623DnaJ domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MMSSSSPTQL ASLRDMGIYE PFQQMVSWRN VFKSDINDHS PNTASSSVIQ VDHNIIKASY  60
PSSSHNQIEA EPSGNDHQEE DDDGRNHDKM KRRLAQNREA ARKSRLRKKA YVQQLEESRF  120
KLSQLEQELE KAKQQGVYSS GSSYVGSSGS INTRIAAFEL EYSHWLEEQS RRVSEIRTAL  180
QAHISDIELK MLVESCLNHY ANLFRMKSDA AKADVFYLIS GMWRTSTERF FQWIGGFRPS  240
GLLNVVMPYL QPLTDQQILE VRNLQQSSQQ AEDALSQGID KLQQSLAENI VIDVVMESND  300
YPSHMGAAVE NLQALEGFVN QVSGSFEATN IAANGKDLDD KTSSSRSKDS NFWFGVRQRK  360
TLVRAASSWS EGKSPYDTLE LERDAEEEQI KVAYRRLAKY YHPDVYDGKG TLEEGETAES  420
RFIKIQAAYE LLMDTEKRRQ YDTDNRVNPM KASQAWMEWL MKKRKAFDQR GDMAIAAWAE  480
QQQLEINLRA RRLSRSKVDP EEERKLLEKE KKASRELFNS TLKRHTLVLK KRDLMRKKAE  540
EDKKKLITQL LAAEGLELDT EEEEEEETAK *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.154400.0microspore-derived embryo| seed| vegetative meristem
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00131848001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533840.0AK353384.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-35-N08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013648680.10.0transcription factor TGA7-like isoform X2
SwissprotQ93ZE20.0TGA7_ARATH; Transcription factor TGA7
TrEMBLA0A0D3CW250.0A0A0D3CW25_BRAOL; Uncharacterized protein
STRINGBo6g081910.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30612766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.11e-178bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]