PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00131390001
Common NameGSBRNA2T00131390001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family BES1
Protein Properties Length: 277aa    MW: 30050.7 Da    PI: 8.4925
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00131390001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822208.81.5e-6421351146
               DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasasp 90 
                          ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR +Gn+klpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp++++e ++ s+sasp
  GSBRNA2T00131390001   2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKGCKPMDRMELMNGSTSASP 91 
                          5899************************************************************************************** PP

               DUF822  91 esslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
                          +ss+q        +sp+ sy++sp+sssfpsp+++      +a+sl+p+l++ls+ 
  GSBRNA2T00131390001  92 CSSYQ--------PSPRGSYNPSPSSSSFPSPTNI----FGDANSLIPWLKNLSSN 135
                          *****........*******************994....34567899999999763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.3E-613132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FAGLRIHGNF KLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKGCKPMDRM ELMNGSTSAS PCSSYQPSPR GSYNPSPSSS SFPSPTNIFG  120
DANSLIPWLK NLSSNSPSKL PFFHGNSISA PVTPPLARSP TRDQVTIPES GWLSGMQTPQ  180
SGPSSPTFSL VSRNPFFDKA AFTMGDCSSP MWTPGQSGNC SPAIPAGVDQ NSDVPMADGM  240
AAEFAFGMVK PWEGERIHGE CVSEDLELTL GNSRTR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.56320.0leaf| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00131390001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0245120.0BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds.
GenBankAY0883790.0AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence.
GenBankAK1188500.0AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009132289.10.0PREDICTED: BES1/BZR1 homolog protein 3
SwissprotO494041e-170BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLA0A078CUP90.0A0A078CUP9_BRANA; BnaA01g09700D protein
TrEMBLM4DA490.0M4DA49_BRARP; Uncharacterized protein
STRINGBra013359.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-152BES1/BZR1 homolog 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]