PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00130073001
Common NameGSBRNA2T00130073001, LOC106443126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 194aa    MW: 22169.3 Da    PI: 6.3028
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00130073001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.84.7e-1375127557
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                          +++rr+ +NRe+ArrsR RK+  ++eL   v+ L +eN++   +l++ ++  +
  GSBRNA2T00130073001  75 RKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQILGKLNKATDSND 127
                          79*************************************99988888777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.5E-1271135IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.00273121IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.1E-1073124No hitNo description
PfamPF001703.1E-1175132IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.59E-1275124No hitNo description
CDDcd147021.15E-1876123No hitNo description
PROSITE patternPS0003607893IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MHPNYDSSSI NNMQQQDYFH LNPYYNNLNP STNNNLNLLS YPQIQEFNNL QSPASNNNST  60
TSDEATEETF VISERKQRRM VSNRESARRS RMRKQRHLDE LLSQVAWLRS ENHQILGKLN  120
KATDSNDLVL QENLILKEEN LELRQVITSM KKLGGAEGGS TSFHGIYCSS SLDHDLDQDF  180
SCITNDPKSH HPS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18794RRSRMRKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00130073001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325540.0AC232554.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH013I08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009131503.11e-142PREDICTED: basic leucine zipper 43-like
RefseqXP_013740176.11e-142basic leucine zipper 43
TrEMBLA0A397ZU971e-140A0A397ZU97_BRACM; Uncharacterized protein
STRINGBra006324.1-P1e-132(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM106321532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15830.13e-74basic leucine-zipper 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]