PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00129538001
Common NameGSBRNA2T00129538001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 604aa    MW: 66024.4 Da    PI: 5.4542
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00129538001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS426.91.6e-1302416002374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lLl+cAeavs+++le+a++lL ++s+l++p+g++ qR+aayf eA++arl++s+ ++y+alp++  ++++s + ++a+++f+ +sP++
  GSBRNA2T00129538001 241 LTLLLQCAEAVSADNLEEANKLLLEISQLSTPYGTSAQRVAAYFSEAMSARLLNSCLGIYAALPSRWMPQTHSLKMVSAFQVFNGISPLV 330
                          579*************************************************************************************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl 181
                          kfsh+taNqaI ea+e+e++vHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g     s e+l++tg+rL++fA++lg+pfef + 
  GSBRNA2T00129538001 331 KFSHFTANQAIQEAFEKEDCVHIIDLDIMQGLQWPGLFHILASRPGGPPHVRLTGLGT----SMEALQATGKRLSDFADKLGLPFEFCP- 415
                          **********************************************************....***************************. PP

                 GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +a+++ +l+ e+L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl
  GSBRNA2T00129538001 416 LAEKVGNLDAERLNVRKREAVAVHWLQ--HSLYDVTGSDTH----TLWLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSL 498
                          59************************9..999988888777....**********************.899******************* PP

                 GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                           a++++eseer++vE++ll++ei+nv+a  g +r  + + +e+Wre+++++GFk ++l  +aa+qa lll +++sdgy++ +++g+l lg
  GSBRNA2T00129538001 499 GASYGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVK-FESWREKMQQCGFKGISLAGNAATQATLLLGMFPSDGYTLVDDNGTLKLG 587
                          *********************************888776.************************************************** PP

                 GRAS 362 WkdrpLvsvSaWr 374
                          Wkd +L+++SaW+
  GSBRNA2T00129538001 588 WKDLSLLTASAWT 600
                          ************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.63214580IPR005202Transcription factor GRAS
PfamPF035145.6E-128241600IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MAESSGKTTS SDNNSSNRTS EMSSSSSLNN NQRPPPPHRA SHLPDSNYIV TAAAADSTTH  60
PTPPVSVCGF SGLPVFPSDN NNNRTAMSVQ PMEQQDSSSS SPTVWVDAII RDLINSSASV  120
SIPQLIQNVR DIIFPCNPNL GALLEYRLRS LMLLDPPPSS SDAPPPQPPF EPLYHQQQQQ  180
PKPPTPPPPQ VQQQERENTP PPPPETVTTT TTTTTTTAEA LRERKEEIKR QKQDEEGLHL  240
LTLLLQCAEA VSADNLEEAN KLLLEISQLS TPYGTSAQRV AAYFSEAMSA RLLNSCLGIY  300
AALPSRWMPQ THSLKMVSAF QVFNGISPLV KFSHFTANQA IQEAFEKEDC VHIIDLDIMQ  360
GLQWPGLFHI LASRPGGPPH VRLTGLGTSM EALQATGKRL SDFADKLGLP FEFCPLAEKV  420
GNLDAERLNV RKREAVAVHW LQHSLYDVTG SDTHTLWLLQ RLAPKVVTVV EQDLSHAGSF  480
LGRFVEAIHY YSALFDSLGA SYGEESEERH VVEQQLLSKE IRNVLAVGGP SRSGEVKFES  540
WREKMQQCGF KGISLAGNAA TQATLLLGMF PSDGYTLVDD NGTLKLGWKD LSLLTASAWT  600
PCS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-512405994374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.95160.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00129538001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1045510.0EF104551.1 Brassica rapa clone scr_5 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013711392.10.0PREDICTED: LOW QUALITY PROTEIN: protein SCARECROW-like
SwissprotQ9M3840.0SCR_ARATH; Protein SCARECROW
TrEMBLA0A078CQ730.0A0A078CQ73_BRANA; BnaA09g34140D protein
STRINGAT3G54220.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81642640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]