PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00125764001
Common NameGSBRNA2T00125764001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 86aa    MW: 10256.9 Da    PI: 10.4202
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00125764001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS79.36.8e-25280296374
                 GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          +v+aceg+er++r et+++W+ r+ +aGF+p++l+++++k+ k l+r+ + + + ++++++++++gWk+r L+++S+W+
  GSBRNA2T00125764001   2 SVIACEGDERFARPETYKQWQVRILRAGFRPAKLNKQIMKEGKELVRERYHKDFVIDNDNHWMFQGWKGRVLYALSCWK 80 
                          69************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098513.639160IPR005202Transcription factor GRAS
PfamPF035142.3E-22280IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MSVIACEGDE RFARPETYKQ WQVRILRAGF RPAKLNKQIM KEGKELVRER YHKDFVIDND  60
NHWMFQGWKG RVLYALSCWK PAKKQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.180311e-133bud| leaf| microspore-derived embryo| root| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00125764001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3527115e-85AK352711.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-05-F16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603051.12e-57PREDICTED: scarecrow-like protein 30 isoform X2
RefseqXP_013672000.12e-57PREDICTED: scarecrow-like protein 30 isoform X2
SwissprotQ9SNB82e-55SCL30_ARATH; Scarecrow-like protein 30
TrEMBLA0A078BX733e-59A0A078BX73_BRANA; BnaC01g24670D protein
TrEMBLA0A0D3A8U75e-57A0A0D3A8U7_BRAOL; Uncharacterized protein
STRINGBra033813.1-P2e-56(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15599616
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46600.34e-57GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]