PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00123985001
Common NameGSBRNA2T00123985001, LOC106360444, LOC106382677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 351aa    MW: 40024.6 Da    PI: 7.9102
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00123985001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.34.6e-2276135357
                          --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          +R+++t++ql++Leel+++ +r+psa+++++++++l    +++ ++V++WFqN++a+e++
  GSBRNA2T00123985001  76 SRWNPTPDQLKALEELYQQgTRTPSADHIQQITAQLrrygKIEGKNVFYWFQNHKARERQ 135
                          7*****************99**************************************97 PP

2Wus_type_Homeobox115.33e-3775137365
    Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          ++RW+Ptp+Q+k Leely++G+rtP++++iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
  GSBRNA2T00123985001  75 SSRWNPTPDQLKALEELYQQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQKR 137
                          79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.04671136IPR001356Homeobox domain
SuperFamilySSF466891.71E-1273141IPR009057Homeodomain-like
SMARTSM003898.3E-673140IPR001356Homeobox domain
PfamPF000468.9E-2076135IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-976135IPR009057Homeodomain-like
CDDcd000863.58E-677137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MWMMGYNEGG ADSFNGGRKL RPLIPRLSSC PTATANTYSD HRFNMAVVTT MTAEQNKREL  60
MMLNSEPQHP PAMVSSRWNP TPDQLKALEE LYQQGTRTPS ADHIQQITAQ LRRYGKIEGK  120
NVFYWFQNHK ARERQKRRRQ MENGHDESVV TTMSLVSNQG FDKKDSKGYK VEQTKNWICS  180
VGCDTQQEKP HDHHHQEEPV SIAMVATKRN GRHGGDEIQS FPVRSARWHM MQLPPGLYPS  240
SQQHHNHHQL NLNSTTVSLN LSTSNSNVSA PKDTVTFSPS FLRTRGARNT EACDDNKDQE  300
QHEDCSNGEL EHQEHTLELF PLRKEGFCSN GGKEKESGIQ CFYEFLPLKN *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00123985001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513940.0AY251394.1 Arabidopsis thaliana WOX1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013655494.10.0PREDICTED: WUSCHEL-related homeobox 1-like isoform X1
RefseqXP_013678172.10.0PREDICTED: WUSCHEL-related homeobox 1-like isoform X1
SwissprotQ6X7K00.0WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLA0A078CGG90.0A0A078CGG9_BRANA; BnaC03g40380D protein
STRINGBra001694.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73972741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.10.0WUSCHEL related homeobox 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]