PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00123296001
Common NameGSBRNA2T00123296001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 202aa    MW: 21738.6 Da    PI: 7.8566
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00123296001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.21e-41201191100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++C+++pyf  ++p++fa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lq+q++ l
  GSBRNA2T00123296001  20 PCAACKLLRRRCAQECPFSPYFSPHEPHRFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQHQIQAL 109
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +ael ++++e
  GSBRNA2T00123296001 110 QAELTAVRSE 119
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.94519120IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4220117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MAGIRRPMSG PHGTLNTITP CAACKLLRRR CAQECPFSPY FSPHEPHRFA SVHKVFGASN  60
VSKMLMEVPE SQRADAANSL VYEANVRLRD PVYGCMGAIS ALQHQIQALQ AELTAVRSEI  120
LKFNQREAVA ALIVPSNSQV AGFHNSSGVS VIAPQPQTPS TPPQPTAADH PPPPSSCVFS  180
QPTTRPLEYG DIESENNSYF G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-432012311114LOB family transfactor Ramosa2.1
5ly0_B6e-432012311114LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00123296001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895960.0AC189596.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH014A02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141907.11e-147PREDICTED: LOB domain-containing protein 15 isoform X2
SwissprotQ8L5T51e-109LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A291LQZ71e-146A0A291LQZ7_BRARR; Transcription factor LBD15
TrEMBLA0A3P6CAJ01e-146A0A3P6CAJ0_BRACM; Uncharacterized protein (Fragment)
STRINGBra016992.1-P1e-147(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-110LOB domain-containing protein 15
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]