PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00123256001
Common NameGSBRNA2T00123256001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 606aa    MW: 66405.7 Da    PI: 5.2746
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00123256001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.81.1e-13164224262
                          XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                           e k+  r+++NRe+A+ sRqRKk ++eeLeekvk++ +  ++L  +++    e a+l+++
  GSBRNA2T00123256001 164 DEKKKRARLMRNRESAQLSRQRKKHYVEELEEKVKSMHSAITDLNGKISYFMAENAALRQQ 224
                          6779999*****************************************9999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-15162227IPR004827Basic-leucine zipper domain
PfamPF001708.3E-12164225IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.128165225IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.91E-12167225No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-16167225No hitNo description
CDDcd147043.44E-20169219No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MAESITEEPP PSEFDPLFDQ LHSSISDQTP IGELMSDLGF PIDADFELTF DGMEDLYLPA  60
EDETFLLPDN GSNQEQFGDF TPESEGSAIF GDTDKNIHRN SESPKDSDDR CSGDERTLDQ  120
LSSQASATKR KKEDDTSDES RSSKLMRSGE ESAVVTGEEE EEEDEKKKRA RLMRNRESAQ  180
LSRQRKKHYV EELEEKVKSM HSAITDLNGK ISYFMAENAA LRQQLGPPPP PMGMYPPIWM  240
HCPPYMVKQQ GGGQVPLIPI PRLKPLNPVK AKSKKSEAKT KKVASITFLG LVFCLFLFGA  300
LAPVVNVNYG GISSGAFYGS YRSNYVTDQV YNQHRNRVLD TSRSNERDSV PPGNGSEPLV  360
ASLFVPRNDK LVKIDGNLII NSILASERAL ASESNESKAD GVVPKDRSLA LPLPDVGMME  420
DMAKHLVRTK AEKQKALSSG FADTLKDQIK TKAASGEMQQ WFREGVAGPM FSSGMCTEVF  480
QFDVSSTSGA IIPASAATNV SSEHNKNATD TQRRKNRRTL RGLAIPLPGS EHQRNSSSKE  540
IKPVSSMVVS VLVDPREGGD GDIDGMIGGP KSLSRVFVVV LQDSAKYVTY SCVLPRPGAP  600
HLMTT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1511517QRRKNRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.168660.0flower
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in salt and osmotic stress responses. Functions as a stress sensor and transducer in a signaling pathway that resembles an ER stress response. Following salt stress, BZIP17 is cleaved by SBT6.1 (S1P) and S2P at the C-terminus and the N-terminal bZIP component is translocated to the nucleus, where it activates the expression of salt stress response genes (PubMed:17662035). Functions as a stress sensor and transducer in ER stress signaling pathway. ER stress induces proteolysis of BZIP17 by SBT6.1 (S1P) and S2P, and the N-terminal bZIP component is translocated to the nucleus, where it activates the expression and production of ER chaperones, as well as protein involved in brassinosteroid (BR) signaling, which is required for stress acclimation and growth (PubMed:20876872). {ECO:0000269|PubMed:17662035, ECO:0000269|PubMed:20876872}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00123256001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0024092e-82AC002409.3 Arabidopsis thaliana chromosome 2 clone T20B5 map CIC11C08, complete sequence.
GenBankAY1362952e-82AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004082e-82BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankCP0026852e-82CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013727388.10.0bZIP transcription factor 17-like
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A397ZQA40.0A0A397ZQA4_BRACM; Uncharacterized protein
STRINGBra016959.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Zhou SF, et al.
    Membrane-associated transcription factor peptidase, site-2 protease, antagonizes ABA signaling in Arabidopsis.
    New Phytol., 2015. 208(1): p. 188-97
    [PMID:25919792]
  3. Sagor GH, et al.
    The polyamine spermine induces the unfolded protein response via the MAPK cascade in Arabidopsis.
    Front Plant Sci, 2015. 6: p. 687
    [PMID:26442007]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Kim JS,Yamaguchi-Shinozaki K,Shinozaki K
    ER-Anchored Transcription Factors bZIP17 and bZIP28 Regulate Root Elongation.
    Plant Physiol., 2018. 176(3): p. 2221-2230
    [PMID:29367234]
  6. Cifuentes-Esquivel N, et al.
    bZIP17 regulates the expression of genes related to seed storage and germination, reducing seed susceptibility to osmotic stress.
    J. Cell. Biochem., 2018. 119(8): p. 6857-6868
    [PMID:29693271]
  7. Guan P, et al.
    SENSITIVE TO SALT1, An Endoplasmic Reticulum-Localized Chaperone, Positively Regulates Salt Resistance.
    Plant Physiol., 2018. 178(3): p. 1390-1405
    [PMID:30287478]