PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00122637001
Common NameGSBRNA2T00122637001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 118aa    MW: 13873 Da    PI: 9.316
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00122637001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.83.4e-201461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  GSBRNA2T00122637001 14 RGQWTPEEDNKLASYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                         89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.472965IPR017930Myb domain
SMARTSM007173.2E-141363IPR001005SANT/Myb domain
PfamPF002498.3E-191461IPR001005SANT/Myb domain
SuperFamilySSF466891.56E-221589IPR009057Homeodomain-like
CDDcd001671.83E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.7E-66589IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MGRIPCCEKE NVKRGQWTPE EDNKLASYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SDAEEHIIVK FHSVLGNRYD FFIYHLSYGH NIFCTFHFLG CRKLMID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-161489781B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00122637001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893781e-106AC189378.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB049H14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864431.18e-64predicted protein
SwissprotQ9XHV02e-62MYB80_ARATH; Transcription factor MYB80
TrEMBLA0A078F0Z82e-85A0A078F0Z8_BRANA; BnaC02g12480D protein
STRINGAl_scaffold_0008_20492e-63(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-63myb domain protein 103
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]