PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00122214001
Common NameGSBRNA2T00122214001, LOC106420010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YC
Protein Properties Length: 182aa    MW: 20346.9 Da    PI: 9.6277
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00122214001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC48.32.2e-15761631299
                NF-YC  12 katdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                           ++d k  ++P+ ri++i+++d+   +i  +a  l+ ka elfi  ++  ++  + + k++ ++   ++++v++++ ++fl d vp++
  GSBRNA2T00122214001  76 GVEDAKMIRFPMNRIRRIMRSDNSAPQIMQDAVFLVNKATELFIERFSGEAYESSVQDKKKFIHYKHLSSVVSNSERYEFLADCVPEK 163
                          56789999*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008088.2E-2284147IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.104.8E-2485162IPR009072Histone-fold
SuperFamilySSF471132.26E-1894163IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MVSSKKPNQE KKPKSDGVNK AAARNARSSG SKSKKKSNVQ ANVKKEPEVH EISESSSSDS  60
VEETRRDEPM KSNGGGVEDA KMIRFPMNRI RRIMRSDNSA PQIMQDAVFL VNKATELFIE  120
RFSGEAYESS VQDKKKFIHY KHLSSVVSNS ERYEFLADCV PEKVKAEVAL EEWEKSMTDA  180
G*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.157490.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00122214001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7971461e-154KC797146.1 Brassica napus transcription factor subunit NF-YC10A (NF-YC10A) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013716301.11e-130PREDICTED: chromatin accessibility complex protein 1-like
TrEMBLA0A078EYS11e-130A0A078EYS1_BRANA; BnaA09g49120D protein
STRINGBra031606.1-P1e-109(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.12e-66nuclear factor Y, subunit C10
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]