PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00122208001
Common NameGSBRNA2T00122208001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 191aa    MW: 21295.5 Da    PI: 5.8185
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00122208001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.73.6e-42321311100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+C ++Cvlapyfp ++p+kf ++h++FGasn++kll++lpe++r da++slvyeAear+rdPvyG++g i +lq+q+++l
  GSBRNA2T00122208001  32 PCAACKILRRRCGEKCVLAPYFPPTEPAKFSIAHRVFGASNIIKLLQELPESQRIDAVKSLVYEAEARIRDPVYGSTGAIYNLQRQVSEL 121
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +aela+++ e
  GSBRNA2T00122208001 122 QAELAKAQVE 131
                          *****99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.34131132IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4132129IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MPDMESKGDA SAAIIYASPA SSPPPPRVVL SPCAACKILR RRCGEKCVLA PYFPPTEPAK  60
FSIAHRVFGA SNIIKLLQEL PESQRIDAVK SLVYEAEARI RDPVYGSTGA IYNLQRQVSE  120
LQAELAKAQV EIVSMQFQRS NLLELINNMD QPNQDQHKMM AFEKSNDFGF LEDKYFNTNS  180
LMLWCDPLLI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-423113310112LOB family transfactor Ramosa2.1
5ly0_B3e-423113310112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.244761e-66leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00122208001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013694013.11e-130LOB domain-containing protein 1-like
SwissprotQ9LQR06e-94LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A3N6REW41e-128A0A3N6REW4_BRACR; Uncharacterized protein
STRINGBra031599.1-P1e-125(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-94LOB domain-containing protein 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]