PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00122195001
Common NameGSBRNA2T00122195001, LOC106419976
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 315aa    MW: 34409.8 Da    PI: 9.3978
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00122195001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof97.87.3e-3176134361
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                          e alkcprC+s ntkfCy nny+ +qPr++CkaCrryWt+GG lr+vP Gg rr+n k+
  GSBRNA2T00122195001  76 EGALKCPRCNSINTKFCYNNNYNPTQPRHYCKACRRYWTHGGKLRDVPEGGRRRRNSKK 134
                          6689**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2163123IPR003851Zinc finger, Dof-type
PfamPF027016.9E-2978133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.24579133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MVFSSNWSQP TNPNQLQLNE NGSLVNGHGL LSHQLPPFPQ NPNPNHHHAA ASSGLPARLV  60
GFMAERANQT KAPRPEGALK CPRCNSINTK FCYNNNYNPT QPRHYCKACR RYWTHGGKLR  120
DVPEGGRRRR NSKKNKNGNA KSSSTVNAPS SSSGQLRTNH QFPFLPTLQN LTQLGGIGLN  180
LAAANGNNQA HHIGPSLMND LGFLHVGNER NSHDNNNSEN NLMGPGGFPL FDPTSGPYGF  240
QNEGNIENDV GLSFPSTSMV DSSIYQTGPV KMEEQPNLVN LSRPVSGLTH PVNQTNQYYW  300
NNSDFSGPSS NDHH*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In roots, confined to the central cylinder (vascular tissue and pericycle) of both main and lateral roots. In leaves, expressed in the vasculature, mostly in phloem cells. Also present in the vasculature of stems and in stamen filaments of flowers. Detected at low levels in the vasculature of petals and carpels. {ECO:0000269|PubMed:16740150}.
UniprotTISSUE SPECIFICITY: Expressed in the vasculature (mainly in the phloem and associated cell files) of cotyledons, leaves, roots, flower stalks and petals (PubMed:10758484, PubMed:16740150, PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE) (PubMed:30626969). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). Involved in the regulation of root development (PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Element of a regulatory network controlling indole glucosinolates (IGS) biosynthesis, probably by inducing the expression of accurate genes (e.g. CYP83B1). Promotes apical dominance (PubMed:16740150). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00122195001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA) (PubMed:10758484). Induced transiently in response to the generalist herbivore S.littoralis. Triggered by methyl jasmonate (MeJA) and wounding (PubMed:16740150). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842840.0FJ584284.1 Brassica rapa subsp. pekinensis OBF binding protein 2 Dof1.1-1 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013716265.10.0dof zinc finger protein DOF1.1
SwissprotQ8L9V61e-134DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLA0A3P5Y9M50.0A0A3P5Y9M5_BRACM; Uncharacterized protein
STRINGBra031588.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.33e-95Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]