PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00121789001
Common NameGSBRNA2T00121789001, LOC106449684, LOC106449685
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 187aa    MW: 22024.8 Da    PI: 7.7899
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00121789001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.63e-0975127557
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                          +r +rk +NRe+ArrsR +K++ +ee      +L+ eN++L +++    ++ +
  GSBRNA2T00121789001  75 RRKKRKLSNRESARRSRVKKQKHLEEMNIQLNQLKIENRELENQIRYVLQHFQ 127
                          799***********************************999988876655555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.1E-969122No hitNo description
SMARTSM003385.0E-1171135IPR004827Basic-leucine zipper domain
PfamPF077161.1E-672120IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.05973136IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.76E-975125No hitNo description
CDDcd147025.27E-1876127No hitNo description
PROSITE patternPS0003607893IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MMSTIHPVLS CEPGQTTHVP AFETGFTPWD NSHLFSVFDS SMNIIPHSVH EYLSPDSVNR  60
SGPDVVPTDS YTDERRKKRK LSNRESARRS RVKKQKHLEE MNIQLNQLKI ENRELENQIR  120
YVLQHFQRTE TENNRLRLEQ RLLHSMVLNI RQVLMLHQID RSSDYVTWPY DNNTRVTVQH  180
DPVCDF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17380ERRKKRKL
27495RRKKRKLSNRESARRSRVKKQK
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00121789001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013746865.11e-137basic leucine zipper 4-like
RefseqXP_013746866.11e-137basic leucine zipper 4-like
TrEMBLA0A0D3DRP41e-135A0A0D3DRP4_BRAOL; Uncharacterized protein
STRINGBo8g079020.11e-136(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.13e-62basic leucine-zipper 5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]