PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00121409001
Common NameGSBRNA2T00121409001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 257aa    MW: 28458.4 Da    PI: 6.0368
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00121409001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.95.3e-2196156257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          r+R+t+t+ ql++Le+ F + + +ps++++++++++l    +++e++V++WFqNrRa+ k+
  GSBRNA2T00121409001  96 RQRWTPTPVQLQILERIFDQgTGTPSKQKIKDITEELsqhgQISEQNVYNWFQNRRARSKR 156
                          89*****************99**************************************97 PP

2Wus_type_Homeobox103.61.3e-3395158265
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          ar+RWtPtp Q++iLe+++++G+ tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
  GSBRNA2T00121409001  95 ARQRWTPTPVQLQILERIFDQGTGTPSKQKIKDITEELSQHGQISEQNVYNWFQNRRARSKRKQ 158
                          789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.93392157IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-1792159IPR009057Homeodomain-like
SMARTSM003894.3E-1494161IPR001356Homeobox domain
SuperFamilySSF466891.07E-1795158IPR009057Homeodomain-like
CDDcd000861.03E-1296158No hitNo description
PfamPF000467.7E-1996156IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MMEWDNNHQQ QPNNHNSSNL QGIDVSGGGS SSGGMYVKVM TDEQLETLRK QIAIYATICE  60
RLVEMHKTLT SQQDLAGGRL GGLYVDPTIG HKMTARQRWT PTPVQLQILE RIFDQGTGTP  120
SKQKIKDITE ELSQHGQISE QNVYNWFQNR RARSKRKQHG GGGGVGSSNN NNGESEVETE  180
TETLNGKRKM PESLRVLPDG NNGIGTTSTT SPRPEDLCFQ SPEMSSDLHL LGVLSNPRDD  240
HSYNLYDHVE EYGMSG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149157RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.226020.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00121409001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895411e-112AC189541.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH004A18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013645925.11e-163PREDICTED: WUSCHEL-related homeobox 13-like
SwissprotO817881e-135WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A078CEH40.0A0A078CEH4_BRANA; BnaA01g01910D protein
STRINGBra011623.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46202851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-119WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]