PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00120291001
Common NameGSBRNA2T00120291001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 279aa    MW: 30542.9 Da    PI: 5.1845
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00120291001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1543.7e-17120168351
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                          ++kr rr+++NR++ArrsRqRK+++++ Le  v++L++ N++L k+l  
  GSBRNA2T00120291001 120 DVKRIRRMYSNRISARRSRQRKQEQLADLESQVDSLKGVNSTLYKQLID 168
                          68*****************************************988755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.7E-13113173No hitNo description
SMARTSM003381.7E-14118182IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.358120166IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.18E-12121171No hitNo description
PfamPF001704.1E-14121166IPR004827Basic-leucine zipper domain
CDDcd147024.00E-18123174No hitNo description
PROSITE patternPS000360125140IPR004827Basic-leucine zipper domain
PfamPF124981.2E-4189267IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MDGHTAKDIG MKKSASELAL QELLTKFPLD PSFDLMNWDY TCELRDSLLK SESLTPAGFF  60
LDAQSSICEN LSADSPVSAN KPEAKRPARG TVSVYTDDHS DEEDAETEAG QSEMTNDPND  120
VKRIRRMYSN RISARRSRQR KQEQLADLES QVDSLKGVNS TLYKQLIDAT QQFRTAGTNN  180
RVLKSDVETL RVKVKLAEDL IARGSLTSSL NQLLQTHLSP PQHSINSLHY TGNNTSPAIT  240
VHSDQSLFPG ITISGQNSSP GLGNVSSEAV SCVSDIWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134140RRSRQRK
2134141RRSRQRKQ
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Present in silique vasculature and funiculi. In the anthers, restricted to the connective tissue at pre- and post-dehiscence stages and detected in the vascular tissue of the stamen filament. {ECO:0000269|PubMed:18841482}.
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, stems, young leaves, and flowers, mostly in vascular tissues (e.g. phloem). {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00120291001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by glucose. {ECO:0000269|PubMed:18841482}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013678102.10.0basic leucine zipper 9-like
SwissprotQ9FUD31e-168BZIP9_ARATH; Basic leucine zipper 9
TrEMBLA0A3P6B9K80.0A0A3P6B9K8_BRACM; Uncharacterized protein
STRINGBra020471.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63702641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.11e-157basic leucine zipper 9
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  3. Ortiz-EspĂ­n A, et al.
    Mitochondrial AtTrxo1 is transcriptionally regulated by AtbZIP9 and AtAZF2 and affects seed germination under saline conditions.
    J. Exp. Bot., 2017. 68(5): p. 1025-1038
    [PMID:28184497]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]