PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00120014001
Common NameGSBRNA2T00120014001, LOC106400110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 335aa    MW: 36921.8 Da    PI: 7.6219
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00120014001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.69.1e-151050242
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                         +i n+  r+ t+ kR++g+lKK +ELS+LC++ +  ii+s+
  GSBRNA2T00120014001 10 FILNNASRKATYKKRKKGLLKKVHELSTLCGIPAGAIIYSP 50
                         788999*********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.694149IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-21160IPR002100Transcription factor, MADS-box
CDDcd002662.35E-17285No hitNo description
SuperFamilySSF554553.27E-22295IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-8323IPR002100Transcription factor, MADS-box
PfamPF003196.6E-151051IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MTRKKVKLAF ILNNASRKAT YKKRKKGLLK KVHELSTLCG IPAGAIIYSP YDPTPEVWPD  60
ADGIQQVIAA FRSLPELERH KNMVNQEEYL KQRIEKAGKI LKKQTRDNRE VHFTEVMYQC  120
LMGNMGVAGA RAMDLNDLGF LIDQYLNCLD RRIETLLGSS NMEIGESSNA VAAMDQDPSE  180
PAGTLPLVEG ATAPASAVHG VGSSSSSAAG GGGASFNQMY PFPQNQQMFY QPSAPFAGYY  240
EQPPSQNQFM EMMNRPEHMQ AYAANQMGFP FMENAHHYRQ PNQPQPQQFF PGESSTAPQR  300
PFFPGESSAP PPPGTSGSEP PATAPYPPNN IWFR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFILNNASRKATYKKRK
22125KKRKK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00120014001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6084923e-40AB608492.1 Raphanus sativus DNA, microsatellite locus RsSH024, cultivar: rat-tail radish.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013695970.10.0agamous-like MADS-box protein AGL80
SwissprotQ9FJK32e-82AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A3P6FJD50.0A0A3P6FJD5_BRAOL; Uncharacterized protein
STRINGBo5g145000.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.19e-75AGAMOUS-like 80
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]