PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00119961001
Common NameGSBRNA2T00119961001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 1032aa    MW: 115323 Da    PI: 9.7101
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00119961001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.65.3e-074577336
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS
      Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRt 36
                          WT+ E e+++d+ +++G + W+++a+ + + R+
  GSBRNA2T00119961001 45 QWTKAELERFYDYYRKYGQD-WRKVAAAIRNSRS 77
                         6*****************99.*****99886666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.14E-74492IPR009057Homeodomain-like
CDDcd001670.007344689No hitNo description
SMARTSM011353.2E-61621722IPR033471DIRP domain
PfamPF065844.8E-32621721IPR033471DIRP domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1032 aa     Download sequence    Send to blast
MAPAVRKSRS VNKRFTNEPS PRKDAGSSRK SKQRKTKFSD KLGPQWTKAE LERFYDYYRK  60
YGQDWRKVAA AIRNSRSVDM VEALFNMNKA YLSLPEGTAS VAGLIAMMTD HYSVMEGSGS  120
EGEGLDVPEA PRKQQKRKRA KPQLSDSREE DDRQQHPVAS SDGCLKFLKQ ARANGTHRRA  180
TGKRTPRVPV QTSRDDGEGA TPPNKRARKQ RDANDDVAAH FLALTLKDAS RREGSPQVSE  240
SPNKRIEPSD NSPIKSWGKM SRTRKASREK KLESDREDVE GVGEMEAPRK VKRVYKKRVR  300
VEEAECNDSD DNGGACSATE GRRIKSKRRK AGVEASRGTY SPRSPKEEDN KFTSGDEFDA  360
LQALADLSAS FLPGALMESE SSAQLKEERI ENDMDEKSSS PDDSHGEKAD SEPDDSLLHA  420
ISAIGNAAYS RKPKSSRQPS TDCNAVPTEK LEPEPISGSS RRKRKPKKLW DETPAESTRK  480
KSTNKQKELA QEDVNMKSSL RTKRSGQGPP QSKQLKAVKE LEESTTTTSD KKRSAMDVVE  540
VATTKEVSDS GAASIPQKPP NRRKMSLKKS LQERDNKSSE TIHKASRSSR SLSEQELLLK  600
DKLSTSLSHP LARRRCMFEW FYSAIDHPWF AKMEFVDYLN HVGLGHIPRL TRLEWSVIKS  660
SLGRPRRFSE RFLQEEREKL KQYRESVRKH YTELRTGARE GLPTDLARPL AVGNRVIAIH  720
PKTREIHDGK ILTVGHSQCN VLFDDLGVEL VKDIDCMPSN PLEYMPEGLR RQVDKCLSIK  780
KEAQLSGVSV IFPPCGLENV DFSMNQSLNQ GDMVAPILHG KVLASPHQTS QPCIINYSKG  840
REAEIQRVLA LQHALDEKEM EPEMVEIVKG SKTRAQAMVD AAIKAASSVK EGEDAIKMIQ  900
EALDMVGKHQ PLRSSVVKHE EHANGGVEHH QNPSPSSDAS KPVANNDFIS QDGSEKNEAQ  960
MPSELVTSCV ASWLMIQMCT ERQYPPSDVA QLIDTAVTSL QPRCPQNLPI YREIQMCMGR  1020
IKTQILSLVP S*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134141QKRKRAKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.87430.0flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00119961001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013586682.10.0PREDICTED: protein ALWAYS EARLY 2-like isoform X1
SwissprotQ6A3330.0ALY2_ARATH; Protein ALWAYS EARLY 2
TrEMBLA0A078EW270.0A0A078EW27_BRANA; BnaC05g46410D protein
STRINGBra039443.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29622241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21430.27e-80DNA binding
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]