PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00119696001
Common NameGSBRNA2T00119696001, LOC106422713
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 192aa    MW: 21832.3 Da    PI: 7.1958
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00119696001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.3e-202788157
                         TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         ++ R+++t eq++ L +lF+   r+ps++++++++++l    +++ ++V++WFqN++a+e++
  GSBRNA2T00119696001 27 KCGRWNPTVEQVKLLTDLFKAgLRTPSTDQIQKISTELsvygKIESKNVFYWFQNHKARERQ 88
                         568*****************99**************************************97 PP

2Wus_type_Homeobox111.54.4e-362790265
    Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         ++ RW+Pt eQ+k+L++l+k+GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk+
  GSBRNA2T00119696001 27 KCGRWNPTVEQVKLLTDLFKAGLRTPSTDQIQKISTELSVYGKIESKNVFYWFQNHKARERQKR 90
                         678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.5762489IPR001356Homeobox domain
SMARTSM003895.1E-42693IPR001356Homeobox domain
PfamPF000468.2E-172888IPR001356Homeobox domain
SuperFamilySSF466897.7E-112991IPR009057Homeodomain-like
CDDcd000861.95E-43090No hitNo description
Gene3DG3DSA:1.10.10.601.7E-73088IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MSLEGFSTKA RGLGNNNNMG GGGTGTKCGR WNPTVEQVKL LTDLFKAGLR TPSTDQIQKI  60
STELSVYGKI ESKNVFYWFQ NHKARERQKR RTISTVDYDH RQDTNLSLSY RHNPCHHQTP  120
PKDTFEGREE EENVIETLQL FPLSKVERAD ITAASYDEYI REHVNTTVFS TYSSCGAEME  180
HPPLDLRLSF L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2347450.0AC234745.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH034G13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013718944.11e-144PREDICTED: WUSCHEL-related homeobox 7-like
SwissprotQ8H1D29e-78WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLA0A078EUQ31e-144A0A078EUQ3_BRANA; BnaAnng01480D protein
STRINGBra028749.1-P1e-117(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40142857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.13e-71WUSCHEL related homeobox 5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]