PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00119645001
Common NameGSBRNA2T00119645001, LOC106422686
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 214aa    MW: 24184.7 Da    PI: 5.5533
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00119645001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.7e-1299143347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +W++ E++l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  GSBRNA2T00119645001  99 PWSENEHKLFLIGLDRYGKGDWRSISRNVVVTRTPTQVASHAQKY 143
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.516151IPR017877Myb-like domain
SMARTSM007178.6E-6253IPR001005SANT/Myb domain
SuperFamilySSF466892.64E-11459IPR009057Homeodomain-like
CDDcd001679.48E-5651No hitNo description
PROSITE profilePS5129417.59392148IPR017930Myb domain
SuperFamilySSF466891.22E-1594149IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-1695147IPR006447Myb domain, plants
SMARTSM007171.3E-796146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-998142IPR009057Homeodomain-like
CDDcd001675.68E-799144No hitNo description
PfamPF002491.2E-1099143IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MASSQWTRSE DKMFEEALVF FPEGSPNRWE RIADQLHKPV GEVREHYEAL VHDVFQIDSG  60
QVDVPDYIDD SAAAAGWDSA GQISFGTKHS EGERKRGTPW SENEHKLFLI GLDRYGKGDW  120
RSISRNVVVT RTPTQVASHA QKYFLRQNSV KKERKRSSIH DITTVDTSLA MPDSNMEWSG  180
QHESPVQTQQ QIVSEFGQQL TPGGHFEDFG FGM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893881e-174AC189388.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB053D06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013718915.11e-159PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-57DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A078EVB21e-159A0A078EVB2_BRANA; BnaAnng01040D protein
STRINGBra028780.1-P1e-153(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51272750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-127MYB family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]