PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00117854001
Common NameGSBRNA2T00053811001, GSBRNA2T00117854001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 177aa    MW: 20555.9 Da    PI: 6.1281
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00117854001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.75.2e-1386136555
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                          +++rr+ +NRe+ArrsR RK+  ++eL   v +L +eN  L+++l + +++
  GSBRNA2T00117854001  86 RKQRRMLSNRESARRSRMRKQRHLDELWSQVISLRNENNCLIDKLIRVSDT 136
                          79****************************************999887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-1282146IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.35884147IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.1E-1286159No hitNo description
SuperFamilySSF579597.74E-1286133No hitNo description
PfamPF001705.2E-1186144IPR004827Basic-leucine zipper domain
CDDcd147022.51E-1787134No hitNo description
PROSITE patternPS00036089104IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MTPAEITGYY QYLSPEKLST IPAEFNMLNM PTSPISSSSL NYLNDLIINN NYSLSSNGQD  60
LMMSNNSTSD EDYHQHHQSI TALDERKQRR MLSNRESARR SRMRKQRHLD ELWSQVISLR  120
NENNCLIDKL IRVSDTQDNV LKENSKLKEE VSDLRQLVSE LKPNKNNSFL REFEEV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198105RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00262DAPTransfer from AT2G04038Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00117854001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610371.11e-125PREDICTED: basic leucine zipper 43-like
TrEMBLA0A078H6H71e-124A0A078H6H7_BRANA; BnaC09g22200D protein
STRINGBo9g075700.11e-124(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04038.19e-68basic leucine-zipper 48
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]