PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00117126001
Common NameGSBRNA2T00117126001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 629aa    MW: 69403.8 Da    PI: 6.8266
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00117126001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-093553921954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  GSBRNA2T00117126001 355 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 392
                          554459******************************88 PP

2BELL97.51.1e-31248313166
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkd 66 
                          erqe+++kkakL s+l+eV++rY+qy++q+q+vissFe++ag gsak+YtslAlk+iSr+ + +  
  GSBRNA2T00117126001 248 ERQEIHMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGTGSAKSYTSLALKTISRQLKFVDH 313
                          79**********************************************************987655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-58168316IPR006563POX domain
PfamPF075262.4E-39174309IPR006563POX domain
PROSITE profilePS5007112.26333396IPR001356Homeobox domain
CDDcd000862.81E-12336397No hitNo description
SMARTSM003892.3E-9336400IPR001356Homeobox domain
SuperFamilySSF466895.56E-17337403IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-29339402IPR009057Homeodomain-like
PfamPF059202.5E-18353392IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MAAYFHGNPP EISAGSDGSL QTLILMNPTT YVQYTQQDDD SNNNNSNKTN ISNNSFVFLD  60
SHAPPQNASQ QFIGIPLSGH EAASITSADN ISVLQGYPPR VQYNHYSSHQ VDSSHQQAAC  120
ETPRAQQGLF LTLSSQQQQQ QHQNQHQTLH HVGLGSGPGQ DIRVGSGSTG IATLVSSKYL  180
EAAQELLDEV VKADSNDINT RSQLFSSKKG TSETDNKAVG ESSTGAGEGS GGGGEASEKH  240
TVELGTVERQ EIHMKKAKLS SMLHEVEQRY RQYHQQMQMV ISSFEQAAGT GSAKSYTSLA  300
LKTISRQLKF VDHHLRQQRA LQQLGMIQHH PSNNAWRPQR GLPERAVSVL RAWLFEHFLH  360
PYPKDSDKHM LAKQTGLTRS QVSNWFINAR VRLWKPMVEE MYVEEMKEQG KNMGSMEKTP  420
NLDQNNEDSA SKSTSNQEKS PMGGGGANNY HLNPNHNGDL EVVTGMQGSP KRLRTNEETM  480
MQPINADFNS NDKLTMKILE ERQGIRSDGG YPFMGNFGQY QMDEMSRFDV AVSDQELLAQ  540
RYSGNNNGVS LTLGLPHCDS LSSTRHQGFM QTHHGIPIGR RVKIGDTEEY GSANISAATV  600
HSSAAAYSAM NIQNQKRYVA QLLPDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16342400563Homeobox protein Meis2
3k2a_B2e-16342400563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.244221e-139flower| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00117126001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893800.0AC189380.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB050K06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636675.10.0PREDICTED: BEL1-like homeodomain protein 1 isoform X2
RefseqXP_013636676.10.0PREDICTED: BEL1-like homeodomain protein 1 isoform X2
RefseqXP_013636677.10.0PREDICTED: BEL1-like homeodomain protein 1 isoform X2
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLM4CM730.0M4CM73_BRARP; Uncharacterized protein
STRINGBra005310.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]