PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00114830001
Common NameGSBRNA2T00114830001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 284aa    MW: 31334.6 Da    PI: 6.5701
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00114830001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.85.1e-152888257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         r+R+++++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  GSBRNA2T00114830001 28 RSRWSPKPEQILILESIFNSgIVNPPKDETVRIRKMLeqfgAVGDTNVFYWFQNRRSRSRR 88
                         89*****************99*************************************997 PP

2Wus_type_Homeobox106.12.2e-342790265
    Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         +r+RW+P+peQi iLe++++sG+++P+k+e+ ri+++Le++G+++d+NVfyWFQNr++R+r++q
  GSBRNA2T00114830001 27 VRSRWSPKPEQILILESIFNSGIVNPPKDETVRIRKMLEQFGAVGDTNVFYWFQNRRSRSRRRQ 90
                         589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.27E-142295IPR009057Homeodomain-like
PROSITE profilePS5007111.1592489IPR001356Homeobox domain
SMARTSM003898.7E-62693IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-82894IPR009057Homeodomain-like
PfamPF000461.1E-122888IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048830Biological Processadventitious root development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MNQEGSSQSP TGQCRSPSAP SNSTAPVRSR WSPKPEQILI LESIFNSGIV NPPKDETVRI  60
RKMLEQFGAV GDTNVFYWFQ NRRSRSRRRQ RQLQAATAAA VTSRGAEDQQ HMTPMSMHHP  120
YSNNEINLGF GSCSNSSANY FFNDPSSQVS SFLLGHSSSS SNGGCESNNG MENLFAMYGH  180
ESDHPHLHQH SSNDATISNP SDQNSSFHYQ QGLITVFING VPTEVTEGAI DMKAMFGEDL  240
ALMHSSGLPL PIDEFGFLMH SLQHGQSYFL TIMSRTQFSL YLS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00114830001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894500.0AC189450.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB071M18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009126209.11e-171PREDICTED: WUSCHEL-related homeobox 12-like
SwissprotQ8GY251e-121WOX12_ARATH; WUSCHEL-related homeobox 12
TrEMBLA0A078ENF50.0A0A078ENF5_BRANA; BnaC02g07490D protein
STRINGBra023638.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28192768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.21e-109WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]