PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00113656001
Common NameGSBRNA2T00113656001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 240aa    MW: 25796.9 Da    PI: 6.8415
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00113656001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1271e-08781161351
                          HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                          NReA r++R++Kka+ + Le++v  L a N++L k+l+ 
  GSBRNA2T00113656001  78 NREAVRKYREKKKAKAASLEDEVIRLRAVNSQLMKRLQG 116
                          **********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-1363134No hitNo description
SMARTSM003385.6E-866133IPR004827Basic-leucine zipper domain
PfamPF077162.2E-1370123IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.04E-772116No hitNo description
CDDcd146861.62E-1178124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MDDGEVEFPL SSSSMDSFFD ELLRDSHACT HTHTCNPPGP ENTHTHTCLH VHTKILPAKA  60
DDTSESSGSK SKKTPLGNRE AVRKYREKKK AKAASLEDEV IRLRAVNSQL MKRLQGQAAL  120
EAEVTRLKCL LVDIRGRIEG EIGAFPYQKR AVPYSYTMQP CDNVPCGVDN SLYCFQDGDG  180
GEGALMNGQG MNGCEFDQLQ CLGGDQDLAG CSNGNGTFGV NASGVGNKRK RGTPAAKAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.98950.0leaf| microspore-derived embryo| seed
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00113656001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013736814.11e-177basic leucine zipper 23-like
RefseqXP_013736815.11e-177basic leucine zipper 23-like
RefseqXP_013736816.11e-177basic leucine zipper 23-like
SwissprotQ8GTS21e-127BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A398A3961e-156A0A398A396_BRACM; Uncharacterized protein
TrEMBLM4D9881e-156M4D988_BRARP; Uncharacterized protein
STRINGBra013048.1-P1e-157(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-117bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]
  2. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  3. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  4. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]