PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00111212001
Common NameGSBRNA2T00111212001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 277aa    MW: 30705.4 Da    PI: 9.7641
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00111212001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573116.41.6e-3667158297
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                           fqrlwseeDe++lLqG+idfka+ gksp++d+d+fye ++ksisf++sk q+v+Kir+LK+K+ +k k+   g e s++k+hd ++++l
  GSBRNA2T00111212001  67 SFQRLWSEEDEVSLLQGMIDFKADSGKSPYEDMDRFYELASKSISFEASKIQFVDKIRSLKRKYMGKAKH---GAE-SLTKAHDIDCLKL 152
                          69****************************************************************9999...655.9************ PP

               DUF573  92 skkiWg 97 
                          +  iWg
  GSBRNA2T00111212001 153 ATCIWG 158
                          *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.1E-2868158IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MTKKKLTPLE DPPTASSSDD DQVEALSKSE KPIAVTKPKA VKKRPIETTS VSAKRARTAE  60
EAKKPSSFQR LWSEEDEVSL LQGMIDFKAD SGKSPYEDMD RFYELASKSI SFEASKIQFV  120
DKIRSLKRKY MGKAKHGAES LTKAHDIDCL KLATCIWGLA LDSNSSAKKK KLWLLNLLMV  180
LAGGDKDKEV LINGGGASKS HGVRADDWFE DSFLVGSIAG LGVSEQFVKQ KWSMVTVETK  240
KRMAEKWKLL QAKEMELVLH KTDFMREIGS VIAEAS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.58540.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00111212001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009139615.11e-176PREDICTED: mediator-associated protein 1-like isoform X2
TrEMBLA0A078EGF20.0A0A078EGF2_BRANA; BnaA04g06790D protein
STRINGBra032717.1-P1e-175(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-66DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]