PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00111100001
Common NameGSBRNA2T00111100001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 346aa    MW: 39365.9 Da    PI: 7.871
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00111100001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.42.9e-161050343
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                          en+  r +t+ kRr g+ KK +E+S+LCd+++++i+fs++
  GSBRNA2T00111100001 10 MENEKSRAITLKKRRSGLVKKVKEISTLCDVKACLIMFSPK 50
                         5999***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.554150IPR002100Transcription factor, MADS-box
CDDcd002662.94E-25184No hitNo description
SMARTSM004327.6E-20159IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-9222IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-20393IPR002100Transcription factor, MADS-box
PfamPF003192.9E-161050IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-92237IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-93758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTKKVKLALM ENEKSRAITL KKRRSGLVKK VKEISTLCDV KACLIMFSPK EVEPMVWPSA  60
EAARNLLKDF DALPAFTKKK NETSLESYLK EKTWKVHENL RKKTQKENEE CMMDQLKVQL  120
SSFPKLDDLD VKEIYSLISF SKDAIMHLRK KVGSVQHCPL RDPPVYPFED QVKEFRTTTG  180
GSQENERARK TYEEVNMASI GASKEKQTYY LMDKWIFPSL KQPSPQSHQQ IMMNMASYNN  240
STLDPRCYQS YHPYQGSSSN GDHNLEMAPA FPPILACPDF VGPVSHPYPF DFISHEERSN  300
AINNVFFPET LAPGNGTTAE EGNVGASSFD PSYIMDYPGI NNHHF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00111100001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0116220.0AP011622.1 Brassica rapa subsp. pekinensis DNA, chromosome: Linkage group A5, BAC clone: KBrB038I07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585077.10.0PREDICTED: agamous-like MADS-box protein AGL17
RefseqXP_022558866.10.0agamous-like MADS-box protein AGL17
TrEMBLA0A0D3CL250.0A0A0D3CL25_BRAOL; Uncharacterized protein
TrEMBLA0A3P6F4160.0A0A3P6F416_BRAOL; Uncharacterized protein
STRINGBo5g135120.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.15e-82AGAMOUS-like 48
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]