PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00109658001
Common NameGSBRNA2T00109658001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 167aa    MW: 19581.9 Da    PI: 8.597
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00109658001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.5e-174790146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                         rg+ T+eE++ + ++++++G++ W++Ia++++ gRt++++k++w++
  GSBRNA2T00109658001 47 RGNITPEEQLTIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 90
                         7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.762141IPR017877Myb-like domain
SuperFamilySSF466893.5E-2220100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-112453IPR009057Homeodomain-like
PROSITE profilePS5129424.2914296IPR017930Myb domain
SMARTSM007171.5E-144694IPR001005SANT/Myb domain
PfamPF002495.8E-164790IPR001005SANT/Myb domain
CDDcd001674.40E-115190No hitNo description
Gene3DG3DSA:1.10.10.602.0E-205492IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MWICTYVRTY ESMFDSDDWV YKYIGLKRTG KSCRLRWLNY LRPDVRRGNI TPEEQLTIME  60
LHAKWGNRWS KIAKHLPGRT DNEIKNFWRT RIQKYIKQTD TYSPTTTSYQ HTNMDFNYGN  120
YSAAAATATA TTTADYSIPM TVDDQTGENY WGMDDIWSSM HLLNGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-18289640108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.251391e-127flower| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00109658001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN7039951e-124JN703995.1 Brassica oleracea MYB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111584.12e-93PREDICTED: transcription factor MYB21
SwissprotQ9LK953e-89MYB21_ARATH; Transcription factor MYB21
TrEMBLA0A078EGA11e-123A0A078EGA1_BRANA; BnaC09g01550D protein
STRINGBra039067.1-P5e-93(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.15e-85myb domain protein 21
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]