PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00109570001
Common NameGSBRNA2T00109570001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 97aa    MW: 11148.9 Da    PI: 8.488
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00109570001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS101.71.1e-31193267360
                 GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                          +f+s++++lpr++++ri+vE+++l+r++vn++acega+r+erhe l+kWr+r+ +aGF+p+pls  +++++k+llr+++++ yr+ee++g
  GSBRNA2T00109570001   1 MFESIDVTLPRNHKQRINVEQHCLARDVVNIIACEGADRVERHELLGKWRSRFCMAGFTPYPLSPLVNSTIKTLLRNYSDK-YRLEERDG 89 
                          7******************************************************************************55.******** PP

                 GRAS 357 slvl 360
                          +l++
  GSBRNA2T00109570001  90 ALYI 93 
                          9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035143.6E-29193IPR005202Transcription factor GRAS
PROSITE profilePS5098519.245188IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MFESIDVTLP RNHKQRINVE QHCLARDVVN IIACEGADRV ERHELLGKWR SRFCMAGFTP  60
YPLSPLVNST IKTLLRNYSD KYRLEERDGA LYILVG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00109570001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893051e-118AC189305.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB031O20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009129708.11e-58PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009129709.11e-58PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009129711.11e-58PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013621066.19e-59PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013621067.19e-59PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013621069.19e-59PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013725211.19e-59PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013725212.19e-59PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013725213.19e-59PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013725214.12e-62PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013732060.19e-59PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013732061.19e-59PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013732062.19e-59PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL72e-60PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A078EG401e-67A0A078EG40_BRANA; BnaC09g02250D protein
STRINGBra020715.1-P3e-58(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3172722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-61GRAS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]