PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00108113001
Common NameGSBRNA2T00108113001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 443aa    MW: 47521.9 Da    PI: 9.756
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00108113001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.62.3e-12305363563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          kr +r   NR++A rs +RK ++++eLe kv++L++e ++L  +l +l+  +  l++++
  GSBRNA2T00108113001 305 KRVKRILANRVSAARSKERKTQYMAELEHKVQTLQSEATTLSAQLTHLQRDSMGLTNQN 363
                          899*********************************************99887777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.0E-20301365IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.955303366IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.5E-13305360No hitNo description
PfamPF001704.9E-10305362IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.47E-12305361No hitNo description
CDDcd147039.71E-23306355No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MGGGSGTDAS TVQRANSSSS SIPKQPAPIT PNHHLNPPLL RSPQPFSGGG GAGNRVGAPP  60
PIPSYSQIPA TLQLKHSRST SQPSSFFSFD SLPPLNPSPV SAEERNGAGF SPSLPPSPFT  120
MCHSSSRMVG VGGGDGENLP PRKSHRRSNS DVTFGFSSIM SPPLIPSRSL ERSEEPGEGG  180
GRKKSESEAM DDVFRAYMNL DNIDVLNSFG GNETVDSSGS EGESSVKVSS GVKRRAGGDI  240
VPTGRHYRSV SVDSGFMGKL DLASPTNSGE GNSSVEFGNS EFTAAEMKKI SADEKLAEIV  300
MADPKRVKRI LANRVSAARS KERKTQYMAE LEHKVQTLQS EATTLSAQLT HLQRDSMGLT  360
NQNNELKFRL QAMEQQAQLR DALSEKLTEE VQRLKMVIGE TSSRSSSSRR ESNISKTTLS  420
PEMFQQLSIS QQQMQHSKAQ IK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1317325ARSKERKTQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.172840.0flower| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00108113001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4012981e-131AF401298.1 Arabidopsis thaliana transcription factor bZIP30 (BZIP30) mRNA, complete cds.
GenBankAY0544971e-131AY054497.1 Arabidopsis thaliana putative bZIP transcription factor (At2g21230; F7O24.5) mRNA, complete cds.
GenBankAY0932681e-131AY093268.1 Arabidopsis thaliana putative bZIP transcription factor (At2g21230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013717067.10.0transcription factor RF2a-like
TrEMBLA0A0D3C0Y60.0A0A0D3C0Y6_BRAOL; Uncharacterized protein
STRINGBo4g145800.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156251417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.11e-152bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]