PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00108112001
Common NameGSBRNA2T00108112001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 422aa    MW: 46530.8 Da    PI: 6.4208
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00108112001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.81.3e-09288335451
                          XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                           kr +r+ +NRe+A rs +RK   + eLe kv+ Le++ ++L   l+ 
  GSBRNA2T00108112001 288 PKRLKRRLSNRESAARSKERKALHQFELEVKVERLETQIDTLTAVLKL 335
                          59*************************************999865554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-6285349IPR004827Basic-leucine zipper domain
PfamPF077164.2E-8286332IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.542287339IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.67E-8289339No hitNo description
Gene3DG3DSA:1.20.5.1706.7E-8289352No hitNo description
CDDcd147031.76E-10290341No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MDGHANIPPS YTGLSQYPAT YPYGDESSNR ATMPPPCGSS LPTVPPYYQI TPTIQPSQNF  60
IPGSSPSLSM SSQPSSSLYS FPPLSPSSFL DFPSARVANK EMAYPPLPYT GGSGSSLPSS  120
VFSVPPTYRD FPSATVANND MALPPIAYMM PNSSYAEGSK THKRASSDSI RLNSLMASNR  180
IYPNPIDMPV GVRTQNESVG DKSSSHNEDV NVDVPNGNKR RAGNEIAPPS RIWRSVSAGS  240
SLNEAPSLPQ GVSVDVGNDT AFGGMFTPEQ LRKIAASDEL KAMAASDPKR LKRRLSNRES  300
AARSKERKAL HQFELEVKVE RLETQIDTLT AVLKLEKRER MAADHECARL RTSLDGADEQ  360
ARVHHDLIEQ LNGEVRRLTE EARRLREEVS EYRRRESERM NANMLEQLNI NQFQETDYNF  420
E*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1287293PKRLKRR
2287294PKRLKRRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00108112001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013716937.10.0transcription factor RF2a-like
TrEMBLA0A3P6CVJ30.0A0A3P6CVJ3_BRAOL; Uncharacterized protein
STRINGBra030312.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1940967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-29bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]